KEGG   Azoarcus sp. DD4: CJ010_15270Help
Entry
CJ010_15270       CDS       T06048                                 

Definition
(GenBank) phenol hydroxylase
  KO
K16249  phenol/toluene 2-monooxygenase (NADH) P0/A0
Organism
azr  Azoarcus sp. DD4
Pathway
azr00361  Chlorocyclohexane and chlorobenzene degradation
azr00362  Benzoate degradation
azr00623  Toluene degradation
azr01100  Metabolic pathways
azr01120  Microbial metabolism in diverse environments
azr01220  Degradation of aromatic compounds
Module
azr_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:azr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CJ010_15270
   00361 Chlorocyclohexane and chlorobenzene degradation
    CJ010_15270
   00623 Toluene degradation
    CJ010_15270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phenol_hyd_sub
Motif
Other DBs
NCBI-ProteinID: QDF97794
UniProt: A0A4Y6KU21
LinkDB All DBs
Position
complement(3322100..3322369)
Genome map
AA seq 89 aa AA seqDB search
MPTNQPAIDVSRKFVRLIERRADGFVEFEFAIGEPELCAEMLLPAPAYEAFCRNNAVIEL
AAREPLADGDDETAAWNWNLHQATHQRFR
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaaccagcccgctatcgacgtcagccgcaagttcgtgcgcctcatcgaacgc
cgtgcggacggtttcgtcgagttcgagttcgccatcggcgagcccgagctgtgtgccgag
atgctgctgccggcaccggcttacgaggccttctgccgcaacaacgcggtgatcgagctt
gcggcacgcgaacccttggccgacggcgacgacgagaccgccgcctggaactggaacctg
catcaggcgacgcaccagcgtttccgctga

DBGET integrated database retrieval system