KEGG   Azoarcus sp. DD4: CJ010_21610
Entry
CJ010_21610       CDS       T06048                                 

Definition
(GenBank) hypothetical protein
Organism
azr  Azoarcus sp. DD4
SSDB
Motif
Pfam: Kdo
Other DBs
NCBI-ProteinID: QDF99854
UniProt: A0A4Y6KZS4
LinkDB
Position
4679034..4679810
AA seq 258 aa
MVDYFAPDLRALFTRHRLDSFAALWALELDSVDAPNTGRGGWSSVSRLVLADAEGREHAF
YLKRQIDHLSRSLSKPLGEATFAREFRNILRYAEDGVPALQAAVFGQRRIGGKVCAILVT
RALDDYRPLDAWLRDWPTLPRATRQALIAATADLVRRLHAAGHLHNCLYPKHVFLRAPGS
AGDGPAACLIDLEKTRKLHFGRAALARDLDTLDRHSSEPSTGERLRFLLRYLDQPALDAP
ARKLIRRLLARRRKKAGR
NT seq 777 nt   +upstreamnt  +downstreamnt
atggtggactacttcgcgcccgacctgcgcgccctcttcacccgccatcgcctcgacagc
ttcgccgcgctgtgggcgctcgaactcgacagcgtggacgcgcccaacaccggccgcggc
ggctggagcagcgtcagccggctggttctcgccgatgccgaggggcgggagcacgccttc
tacctcaagcgccagatcgaccacctcagccgcagcctgtcgaaaccgctgggcgaggcg
accttcgcccgcgagttccgcaacatcctgcgctacgcagaagacggtgtaccggcgctg
caggctgccgtcttcggccaacggcgcatcggtggcaaggtgtgcgccatcctcgtcacc
cgcgcgctcgacgactaccggccgctcgacgcctggctgcgcgactggccgaccctgccg
cgcgccactcgtcaggcgctgatcgccgccaccgccgacctggttcgtcgcctgcatgcc
gccggccacctgcacaactgcctctaccccaagcacgtcttcctgcgcgcaccgggcagt
gccggcgacggcccggccgcctgcctgatcgacctggagaagacgcgcaagctgcacttc
ggccgcgccgccctggcacgcgacctcgacaccctcgaccgccacagcagcgagccgagc
accggcgaacggctgcgcttcctgctgcgctacctcgaccagcccgcgctggacgcccca
gcccgcaagctgatccgccggctgctcgcccgtcgccgcaagaaggcgggccgctga

DBGET integrated database retrieval system