KEGG   Azoarcus sp. DD4: CJ010_22255Help
Entry
CJ010_22255       CDS       T06048                                 

Definition
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
azr  Azoarcus sp. DD4
Brite
KEGG Orthology (KO) [BR:azr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CJ010_22255
Enzymes [BR:azr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     CJ010_22255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: QDF99068
UniProt: A0A4Y6KXV1
LinkDB All DBs
Position
4823939..4826065
Genome map
AA seq 708 aa AA seqDB search
MNLPYTLRLASAACLLPLAAGALAAAQAATPAAVDGARIVAADREPGNWMSHGRTYSEQR
YSPLKRIDDRNVGQLGLAWTARLDIDRGIEATPIVVDGVMYTTGAKSIVHAFDARSGKPL
WKFDPQVPGIRLSEGCCDVVNRGVAVWQGKVYVGAYDGRLIALDARDGRKLWETDTVVDH
GRSYTITGAPRVVKGKVLIGNGGAEYGVRGYISAYDADSGKLAWRFYTVPGDPAQEKDDR
AMEIARKTWHGSEYWKQGGGTVWDSMAYDPELDLLYIGTGNASWWNRKARSEGKGDNLFV
SSIVALRPDSGDYVWHYQTTPGDMWDYTATQHIILAELPIAGQTRKVLMQAPKNGFFYVL
DRASGELLSAEKYAPVNWATHVDMETGRPVVDEKAANYLEGPKVISPAFIGAHNWHPMSF
NPQTGLVYIPMQESAGMLSAPADPQRIAHKSVVNLGVDVPDLPEDPAVVKQIAASFKGKL
LAWNPVTQKAAWSQDYRTIYNGGTLSTAGNLVFQGTADGRVTAYAADSGKLLWEAPANTG
VMAGPITYEVGGEQYVTFMAGWGGTFPLILGPLSQEAKVRPEARVLTYKLGGKATLPPPQ
QAPLAVPQPPALTATAEEVAAGRTLYNGFCGSCHGLNAISGGVLPDLRYLDAKKHAQFKD
IVLMGARAAKGMPPFAGTVSEADAARIHQYLIKRAHDLRQETASAARP
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgccgtacaccctgcgcctggcaagcgctgcctgcctgctgccactggctgcg
ggcgccctcgccgccgctcaggccgccacgcccgccgcggtcgacggtgcccgcatcgtc
gcggccgaccgcgaaccgggcaactggatgagccacggccgcacctatagcgaacagcgc
tattccccactcaagcgcatcgacgaccgcaacgtcggccagctcggcctggcctggacc
gccaggctcgacatcgaccgcggcatcgaggccacgcccatcgtggtcgacggcgtgatg
tacaccaccggcgccaagagcatcgtccatgcattcgacgcgcgcagcggcaagccgctg
tggaagttcgatccgcaggtgccgggcatacgcctgtcggaaggctgttgcgacgtggtc
aaccgcggcgtcgcggtgtggcagggcaaggtctacgtcggcgcctacgacggccgcctg
atcgcgctcgacgcgcgcgacggccgcaagctgtgggagacagacaccgtggtcgaccac
ggccgcagctacaccatcaccggtgcgccgcgggtggtgaagggcaaggtgctgatcggc
aacggcggcgccgagtacggcgtacgcggctacatctccgcctacgacgccgacagcggc
aagctcgcctggcgcttctacaccgtgcccggcgacccggcgcaggagaaggacgaccgc
gccatggagatcgcgcgcaagacctggcacggcagcgagtactggaagcagggcggcggc
acggtgtgggattcgatggcctacgaccccgagctcgacctgctctacatcggcaccggc
aacgcctcgtggtggaaccgcaaggcgcgctcggaaggcaagggcgacaacctgttcgtg
tcgtccatcgtcgcgctgcgccccgacagcggcgactacgtctggcactaccagaccacg
ccgggcgacatgtgggactacaccgccacccagcacatcatcctcgccgaacttccgatc
gccggccagacccgcaaggtgctgatgcaggcgcccaagaacggcttcttctacgtgctc
gaccgcgccagcggcgagctgctgtcggccgagaagtacgcgccggtgaactgggccacc
catgtcgacatggagaccggccgcccggtggtggacgagaaggcggccaactacctggaa
ggccccaaggtgatctcgcccgccttcatcggcgcgcacaactggcacccgatgtccttc
aacccgcagaccggcctggtctacattccgatgcaggaaagcgccggcatgctgtcggcg
cccgccgatccgcagcgcatcgcccacaagtcggtggtgaacctcggcgtggacgtgccc
gacctgccggaagacccggctgtggtgaagcagatcgcggccagcttcaagggcaagctg
ctggcgtggaacccggtgacgcagaaggcggcctggagccaggactaccgcaccatctac
aacggcggcacgctgtcgaccgccggcaacctggtgttccagggcacggccgacggccgc
gtcaccgcctacgctgccgacagcggcaagctgctgtgggaagcacccgcaaacaccggg
gtgatggccggcccgatcacctatgaggtgggcggcgagcagtacgtcaccttcatggcc
ggctggggcggcaccttcccgctcatcctcggcccgctgtcgcaagaggccaaggtaagg
ccggaagcgcgcgtgctcacctacaagctcggcggcaaggccaccctgccgccgccgcag
caggcgccgctggccgtaccgcaaccgccggcactgaccgccaccgccgaagaggtcgcc
gccggacgcacgctctacaacggcttctgcggcagctgccacgggctgaacgcgatctcc
ggcggcgtgctgcccgacctgcgctacctcgacgcgaagaagcacgcccagttcaaggac
atcgtgctgatgggcgcgcgcgccgccaagggcatgccgcccttcgccggcacggtgtcc
gaggccgacgccgcgcgcatccaccagtacctgatcaagcgcgcccacgacctgcgccag
gaaaccgccagcgccgcccggccctga

DBGET integrated database retrieval system