KEGG   Azospirillum sp. TSH58: TSH58p_00735Help
Entry
TSH58p_00735      CDS       T05449                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt00564  Glycerophospholipid metabolism
azt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    TSH58p_00735
Enzymes [BR:azt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     TSH58p_00735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: AWJ82108
UniProt: A0A2S1XCZ9
LinkDB All DBs
Position
TSH58_p03:complement(161548..163089)
Genome map
AA seq 513 aa AA seqDB search
MAGVYDLAIVGGGINGCGIARDAAGRGCSVYLCEQKDLGSGTSSASTKLIHGGLRYLEYY
EFRLVREALREREVLWRMAPHIIWPLRFVLPHLPGLRPSWFLRLGLFLYDHLGGREKLPG
TRGLDLRSDPAGKPLKPGFARAFEYSDCWVDDARLVVLNAQDAARMGAAIRTRTRFLSAV
REDGLWTVTVEDARSGQRSSIRARALVNAAGPWVSEVMRQGARSTVDARIRLVQGSHIVV
PKLFDHDRCYIFQNADKRIVFAIPYERDFTLIGTTDNDYQGDPANVRASEAEIAYLCAAA
GEYFAKPVTPADVVWTYSGVRPLYDDGASTAQAATRDYVLALDAPGDGKAALLNIFGGKI
TTYRRLADAAIAKLAPFLPKLAPGASDWSSAGTLPGGDFPADGVAALVAELRGRAPFLPQ
QHLERLARTYGTRARRILDSAARPEDLGQDFGGTLTEAEVRYLMTEEWAETAEDVLWRRT
KLGLRLDAAQAQALDAFMTEERSRRERASDAAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggccggggtctacgaccttgccatcgtcggcggcggcatcaacggctgtggcatcgcg
cgcgatgccgcgggtcgcggctgctccgtctatctgtgcgaacagaaggatctggggtcg
ggcacgtcctcggcctcgacgaagctgatccacggcggcctgcgctacctggaatattac
gaatttcggctggtccgcgaggcgctgcgcgagcgcgaggtgctgtggcgcatggcgccg
cacatcatctggccgctgcgcttcgtcctgccgcatctgcccggcctgcggccttcctgg
ttcctgcggctgggcctgttcctctacgaccatctcggcgggcgggagaagcttccgggc
acacgcgggctcgacctgcggagcgatccggcggggaagccgctgaagccgggtttcgcg
cgcgctttcgaatattcggattgctgggtcgacgacgcgcgtctggtggttctgaacgcg
caggacgccgcccgcatgggtgctgcgatccgcacccgcacccgcttcctgagcgccgtc
cgcgaggacgggctgtggaccgtgacggtggaggacgcgcgcagcggccagcgcagcagc
atccgcgcccgcgcgctggtcaacgccgccggcccttgggtgtcggaggtgatgcggcag
ggcgcgcggtccacggtggacgcccgcatccgtctggtccagggctcgcacatcgtggtg
ccgaagctgttcgaccatgaccgctgctacatcttccagaacgccgacaagcgcatcgtc
ttcgccatcccctacgagcgcgacttcaccctgatcggcaccaccgacaacgactaccag
ggcgatccggcgaacgtccgcgcgtcggaggcggagatcgcctatctctgcgccgccgcc
ggcgagtatttcgccaagccggtgacgcccgccgacgtggtgtggacctactccggcgtc
cgcccgctctacgacgacggcgcctccacggcgcaggcggcgacccgcgactatgtgctg
gcgctcgacgcgccgggcgacggcaaggcggcgctgctcaacatcttcggcggcaagatc
accacctaccgccgtctcgccgacgcggccatcgccaaactggcgcccttcctgccgaag
ctcgctccgggcgcctcggactggagcagcgccgggaccctgccgggcggcgatttcccg
gcggacggcgtcgcggcgctggtcgccgagttgcgggggcgggcgcccttcctgccgcag
cagcatctggagcggctggcgcgcacctacggcacccgcgcccgccggattctcgacagc
gccgcgcgcccggaggatctcggccaggatttcggcggcaccctgacggaggccgaggtc
cgctatctgatgacggaggaatgggcggagaccgccgaggacgtgctgtggcgccggacc
aagctgggcctgcggctggacgccgcccaggcccaggcgctcgacgcgttcatgacggag
gagcgcagccggagggagagggcatccgacgctgcggaatag

DBGET integrated database retrieval system