KEGG   Azospirillum sp. TSH58: TSH58p_14300Help
Entry
TSH58p_14300      CDS       T05449                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt00473  D-Alanine metabolism
azt00550  Peptidoglycan biosynthesis
azt01100  Metabolic pathways
azt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:azt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TSH58p_14300
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TSH58p_14300
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    TSH58p_14300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:azt01011]
    TSH58p_14300
Enzymes [BR:azt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TSH58p_14300
Peptidoglycan biosynthesis and degradation proteins [BR:azt01011]
 Precursor biosynthesis
  Amino acid ligase
   TSH58p_14300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp B12-binding
Motif
Other DBs
NCBI-ProteinID: AWJ84596
UniProt: A0A2S1XJG4
LinkDB All DBs
Position
complement(2309194..2310141)
Genome map
AA seq 315 aa AA seqDB search
MTTHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYRVTAVDVQRDLEGLLRALTDPR
PDAVFNALHGRGGEDGTIQGVLEFLGIPYTHSGVRAAAVAMDKAMTKALLAPVGVRSPKG
LVLTKGELTGGAHPMPAPYIVKPVDEGSTVGVTLVREGQNSPVGDAWTFGERALVEEFIP
GRELTVGVMGGLDGECRALTVTEIRFEAQVYDYTAKYSAGHAVHTVPAQIPEHVAEEAKR
LAVLAHRTLGCRGVSRSDFRWDDRKSGTDGLFFLEINNQPGMTPLSLVPEQAAAVGLTYG
ALVAWMVENAACQLD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcacaagaagcatgtcgccgtcctgatgggcggctggtcggcggagcgcgag
gtgtcgctggtcagcggcgccggcgtcgccaaagcgctggaggaggaaggctaccgcgtc
accgcggtggacgtgcagcgcgacctggaggggctgctgcgcgccctgaccgaccctcgc
cccgatgcggtgttcaacgccctgcacgggcgcggcggcgaggacgggacgatccagggc
gtcctggagttcctcggcatcccctacacccattccggcgtgcgcgccgccgcggtcgcc
atggacaaggcgatgaccaaggcgctgctcgccccggtcggcgtgcgctcgcccaagggc
ctcgtcctcaccaagggcgagctgaccggcggcgcccacccgatgcccgcgccctacatc
gtcaagccggtggacgagggttcgaccgtcggggtcacgctggtgcgcgaggggcagaac
agcccggtcggcgacgcctggaccttcggcgagcgcgccctggtcgaggagttcattccg
ggccgcgagctgaccgtgggcgtcatgggcgggctggacggcgaatgccgcgccctgacc
gttacggagatccgcttcgaagcacaggtgtatgactacacggctaaatacagcgccggt
catgccgttcatactgtgcccgcgcagattcccgagcatgtcgcggaagaagccaagagg
ttggcggtcctggcccaccggaccctgggatgccgcggcgtttcgcgcagcgacttccgc
tgggatgatcgtaaaagtgggaccgacggactctttttcctggaaatcaacaaccagccg
ggcatgacgccgctgtcgctggttcccgaacaggccgctgccgtggggctcacctacggc
gctctcgtcgcttggatggtggagaacgccgcatgtcaactcgactga

DBGET integrated database retrieval system