KEGG   Azospirillum sp. TSH58: TSH58p_18665Help
Entry
TSH58p_18665      CDS       T05449                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt00620  Pyruvate metabolism
azt00680  Methane metabolism
azt00710  Carbon fixation in photosynthetic organisms
azt01100  Metabolic pathways
azt01120  Microbial metabolism in diverse environments
azt01200  Carbon metabolism
Module
azt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:azt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TSH58p_18665
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TSH58p_18665
   00680 Methane metabolism
    TSH58p_18665
Enzymes [BR:azt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TSH58p_18665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AWJ85592
LinkDB All DBs
Position
TSH58_p04:33693..36500
Genome map
AA seq 935 aa AA seqDB search
MTTDAALRPTAPVTDAETGTDDKDFPLREDIRLLGRLLGDTVREQEGDGVYGVIESVRQA
SVRFNRDDDDSARREMAEILNGLPRDTMMSVVRAFSYFLHLANIAEDQHHIRRTRDHAIA
GSPAREGTLPYALERLEAAGVAPDRLAGMLEIAQVSPVLTAHPTEVQRKSILALEHKVAS
LLDTRDRSRLTPEEAEANMDALQEAILTLWRTRMLRPQRLAVIDEVKNGISYYTDTFFAE
LPKLFCRFEDLLAKRFPDRDWSLPPYFRIGSWIGGDRDGNPFVTAPILREAMRLQSTAAL
EHYLTEIHELGGELPLSELLLGTSPELEELAKRSPDHSPHRADEPFRRALTGIYARLAAT
SRTLDQHEALRNAVGKGDPYATSAELLADLEILAASLKAHGAGRLAAGRLRRLIIAVKTF
GFHLAPIDLRQNSDVHQRTVAELLAVAGRCADYAALSEDERIALLAEEIQSPRPLHSPYH
DYSEETAGELAIFFAARQLRETYGPAALPNSIISKTDGASDLLEVALLLKESGLLRPGAE
GDPALGLNIVPLFETIEDLRQAPATMERLFTLPAYRALVTSRGDEQEVMLGYSDSNKDGG
FLTSGWELYKAEIELAKLFDRHGVRMRLFHGRGGSVGRGGGPSYQAILAQPTGAVSGQIR
ITEQGEVIASKYGRPEVGQRNLEVLTAATLEATLLDLENRVEPAESFYAAMERLSELAFG
AYRGLVYETPGFTQYFRTATPISEIATLNIGSRPASRTKSDRIEDLRAIPWVFSWAQCRL
MLPGWYGFGSAVEAWLKEEPDGLALLQRMNRAWPFFKSLLSNMDMVLAKSDLAIASRYAE
LVEDVELRERIFGRIREEWQRTRRHLLAIAGHDELLGENPLLARSIRNRFPYMDPLNHVQ
VELLRRHRAGSSDERVRRGILMSINGVAAGLRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacgccgccctccgccccaccgctccggtcaccgacgccgaaaccggcacc
gacgacaaggatttcccgctgcgcgaggacatccgcctgctcggccgcctgctcggcgac
actgtgcgcgagcaggagggcgacggcgtctacggcgtcatcgagagcgtgcgtcaggcc
tcggtccgcttcaaccgcgacgacgacgactccgcccgccgcgagatggccgagatcctg
aacggcctgccgcgcgatacgatgatgtcggtggtgcgcgccttctcctacttcctgcac
ctcgccaacatcgccgaggaccagcaccacatccgccgcacccgcgaccacgccatcgcc
ggctcgccggcgcgcgagggcaccctgccctacgcgctggagcggctggaggccgccggc
gtcgcgccggaccggctggccggcatgctggagatcgcccaggtcagcccggtgctgacc
gcccacccgaccgaggtccagcgcaagagcattctggcgctggagcacaaggtggcctcc
ctgctggacacccgcgaccgctcccgcctgacgccggaggaggcggaggccaacatggac
gcgcttcaggaggccatcctgaccctgtggcgcacccgcatgctgcgcccgcagcgcctc
gccgtgatcgacgaggtgaagaacggcatctcctactacaccgacaccttcttcgccgag
ctgccgaagctgttctgccgcttcgaggatctgctggccaagcgcttccccgaccgggac
tggtcgctgccgccctatttccgcatcggttcctggatcggcggcgaccgcgacggcaac
cccttcgtcaccgcgccgatcctgcgcgaggcgatgcgcctgcaatccaccgccgccctc
gagcattacctgaccgagatccacgagctgggcggcgagctgccgctgtccgaactgctg
ctcggcacctcgcccgagctggaggagctggccaagcgctcgcccgaccattcgccgcac
cgcgccgacgagccgttccgccgcgccctgaccggcatctacgcccgtctggcggccacc
tcgcgcacgctcgaccagcatgaggcgctgcgcaacgcggtcggcaagggcgatccctac
gccaccagcgccgagctgctggccgatctggagattctggccgcctcgctgaaggcccac
ggggcgggccgtctggccgccgggcggctgcgccgcctgatcatcgcggtcaagaccttc
ggcttccatctggcgcccatcgacctgcgccagaactccgacgtgcaccagcgcacggtg
gcggagctgctggccgtcgccgggcgctgcgccgactacgccgccctgtcggaggacgag
cgcatcgccctgctggccgaggaaatccagagcccgcgcccgctccactcgccctaccac
gactattcggaggagacggcgggcgaactggcgatcttcttcgccgcccgccagctgcgc
gagacctacggacccgccgccctgccgaacagcatcatctccaagacggacggcgcgtcc
gacctgctggaggtggcgcttctgctcaaggaatccggcttgctgcgtccaggggcggag
ggcgacccggcgctcggcctcaacatcgtcccgctgttcgagaccatcgaggatctccgg
caggccccggcgacgatggagcggctgttcaccctgcccgcctaccgcgccctggtcacc
tcgcgcggggacgagcaggaggtgatgctcggctattcggacagcaacaaggacggcggc
ttcctgacctccggctgggagctgtacaaggcggagatcgagctggcgaagctgttcgac
cgccacggcgtgcgcatgcggctgttccacggccgcggcggctcggtcggccgcggcggc
ggccccagctatcaggccatcctggcccagccgaccggcgcggtgtccggccagatccgc
atcaccgagcagggcgaggtcatcgcgtcgaagtacgggcgtccggaggtcgggcagcgc
aacctggaggtcctgaccgcggcgacgctggaggccaccctgctcgacctggagaaccgc
gtcgagccggcggagtccttctacgcggcgatggagcggctgtcggagctggccttcggt
gcctaccgcgggctggtctacgagacgccgggcttcacccagtatttccgcacggccacc
ccgatctcggaaatcgccacgctgaacatcggcagccgtccggcctcgcgcaccaagtcg
gaccgcatcgaggacctgcgcgccattccgtgggtcttctcctgggcgcagtgccgcctg
atgctgccgggctggtacggcttcggcagcgccgtggaagcgtggctgaaggaggagccg
gacgggctcgccctgctccagcgcatgaaccgcgcctggcccttcttcaagtcgctgctg
tccaacatggacatggtgctggccaagagcgacctcgccatcgcctcgcgctacgccgag
ctggtggaggacgtcgaactgcgcgagcgcatcttcggccgcatccgcgaggagtggcag
cgcacccgccgccatctgctggccatcgccggccatgacgagctgctgggcgagaacccg
ctgctggcgcggtcgatccgcaaccgcttcccctacatggacccgctgaaccacgtccag
gtcgagcttctgcggcgccaccgcgccggcagcagcgacgagcgggtgcggcgcggcatc
ctgatgtcgatcaacggcgtcgccgccggcctgcgcaacagcggctga

DBGET integrated database retrieval system