KEGG   Azospirillum sp. TSH58: TSH58p_21865
Entry
TSH58p_21865      CDS       T05449                                 

Definition
(GenBank) histidine kinase
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TSH58p_21865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:azt01001]
    TSH58p_21865
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:azt02022]
    TSH58p_21865
Enzymes [BR:azt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     TSH58p_21865
Protein kinases [BR:azt01001]
 Histidine kinases
  OmpR family
   TSH58p_21865
Two-component system [BR:azt02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   TSH58p_21865
SSDB
Motif
Pfam: HATPase_c HATPase_c_2 HisKA HATPase_c_3
Other DBs
NCBI-ProteinID: AWJ86185
UniProt: A0A2S1XNV9
LinkDB
Position
TSH58_p02:complement(87515..89146)
AA seq 543 aa
MALLPIEARGPDGARGGAELTKGGFSMAGFPGGRLRWLWHSLASRLALLTIVFLAVPVLI
YDQFQRADTTTQTLLLQSAQRQGELIARALEPDLSRANRAALPQLGPILRRFADGNTRLK
LLVRPRALAGNNLMGSDGFYYVAAAPSVPTDDLDAERHQLLEQGVLDRLGASCAGNEPLA
LRLPRSSGGYEILTSVTPINTAFGCWALVTSHTAGGYLESSLGRPYWSTPVVQAAAMIYI
VMAALVMAVLLGVWRNLHRFGDLARDIVSGGIGEGGQGSFTNRNTVPELSGVAEDFDRLV
DTLRESARSLRRAAEDNAHAYKTPIAVIRQSVEPLRRTLSAEDNRSQRALTMIEKSVDKL
DGLVSFGRRMDEAAADLLVPPRRRVDLSDLVERMAGGYTSLLAERQLHMRSRIESGVVVR
ASEDILETVIENLVENAVSFSPPDGTVSVRLSRNGAWAELVVEDEGPGVDPANLPRIFER
YFSQREPGRGMPEDAAAQNQAEATHFGIGLWIVRRNIEAFGGKVRAENRSTGGFRMTVTL
AVA
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggcgctgctgccgattgaggcccgcgggcctgacggcgcgcggggcggggcggaactc
accaagggaggcttctccatggcgggtttccccggcggccggttgcggtggctgtggcat
tcgctggccagccggctggccctgctgaccatcgtcttcctcgcggttccggtgctgatc
tacgatcagttccagcgcgccgacaccacgacgcagaccctgctgctgcaaagcgcgcag
cggcagggcgagctgatcgcccgcgcgttggagccggacctgtcccgcgccaaccgcgcg
gccttgccgcagctcggccccatcctgcgccgcttcgcggacgggaacacacggctgaag
ctgctggtccggccgcgcgccctggccggcaacaatctgatgggcagcgacggcttctac
tacgtcgccgccgcgccttcggtgcccaccgacgatctggacgccgagcggcaccaactc
ctcgaacagggggtgctggaccggctgggcgcctcctgcgccgggaacgagccgctggcg
ctgcgtctgccgcgctcttcgggcggctacgagattctgacctcggtcacgccgatcaac
accgccttcggctgctgggcgctggtgaccagccacaccgccggcggctatctggaatcc
tccctggggcgtccctactggagcacgccggtcgtccaggccgcggcgatgatctacatc
gtcatggcggcgctggtgatggccgtcctgctgggggtgtggcgcaacctgcaccgcttc
ggcgatctggcccgcgacatcgtgtcgggcggcatcggcgagggcgggcaggggtccttc
accaaccgcaacaccgtgccggagctgtccggggtggccgaggacttcgaccggctggtc
gacaccctgcgcgaaagcgcgcggtcgctacgccgcgcggcggaggacaacgcccacgcc
tacaagacgcccatcgcggtcatccgccagtcggtggagccgctgcgccgcaccctgtcc
gccgaggacaaccgcagccagcgcgccctgaccatgatcgagaagtcggtggacaagctc
gacgggctggtttccttcggacggcgcatggacgaggccgccgccgaccttctggtcccg
ccgcgccgccgggtggacctgtccgatctggtcgagcgcatggccggcggctacaccagc
ctgctcgccgaacggcagctccacatgcgctcgcgcatcgaatccggggtggtcgtgcgg
gccagcgaggacatcctggagaccgtcatcgagaatctggtagagaacgccgtcagcttc
tccccgccggacggcaccgtcagcgtgcgtctgtcgcgcaacggcgcctgggcggagctg
gtggtcgaggacgaggggccgggcgtcgatccggcgaacctgccgcgcatcttcgaacgc
tatttctcccagcgcgagccgggacggggcatgccggaggacgcggcggcccagaaccag
gctgaagcgacccatttcggcatcggcctgtggatcgtgcgccggaacatcgaggccttc
ggcggcaaggtccgcgccgaaaaccgctccaccggcggcttccgcatgacggtgaccctg
gcggtggcgtag

DBGET integrated database retrieval system