KEGG   Azospirillum sp. TSH58: TSH58p_27645Help
Entry
TSH58p_27645      CDS       T05449                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
azt  Azospirillum sp. TSH58
Brite
KEGG Orthology (KO) [BR:azt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TSH58p_27645
Enzymes [BR:azt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TSH58p_27645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase DUF1381 Amnionless
Motif
Other DBs
NCBI-ProteinID: AWJ87175
UniProt: A0A2S1XRQ3
LinkDB All DBs
Position
TSH58_p02:1400906..1402039
Genome map
AA seq 377 aa AA seqDB search
MPRSPYGFVLPLLLSLAVATPVAFNPADALAKAAQETVRKQAPKPAAKTVAKTAPQKAAA
SKTAAKPAAVRTVHKAAVHKSATQKAAVRKAAVHRTGKARRAGRVAAGAAAGTVAGAAVF
RPVHAYVLMDAQSGRVLDSENADTLTYPASLTKMMTLLLTFEALERGTLRLDQELPVSRH
ATNQKPSRLNLAVGSTIRVEDAILALTVKSANDVAVVLAEALGGSEEQFAEMMTAKAQAL
GMTSTTFRNASGLPHKEQRTTARDMARLSRAIVSRPAREYAYFSRTRFDWNGTVVPGHNR
LLGRVEGYDGIKTGFINLSGFNLAGSASRNGQRLVAVVLGGTTAASRDREVAELLEQGFG
SAPPKQTVAVTDVKAVR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgttcgccgtacggtttcgtcctgccgctgcttctgtccctggccgttgccacg
cccgtcgccttcaaccctgcggacgccctcgccaaggcggcccaggagacggtgcgcaag
caagcgcccaagcccgccgccaagacggtcgccaagacggcgcctcagaaggccgcggcg
tccaagacggcggcgaagcccgccgccgtccggaccgtgcacaaggccgccgtccacaaa
tcggccacccagaaggcggccgtccgcaaggccgccgtccaccgcaccggcaaggcgcgc
cgtgcgggacgcgtcgccgccggggccgccgccggcaccgtggcgggcgccgccgtcttc
cgcccggtccatgcctatgtgctgatggacgcgcagtcgggccgggtcctcgattcggag
aacgccgacacgctgacctacccggcgtcgctgaccaagatgatgaccctgctcctgacc
ttcgaggcgctggagcggggcacgctgcggctggaccaggaactgccggtctcgcgccac
gccaccaaccagaagccgtcgcgcctgaacctcgccgtcggctcgaccatccgggtggag
gacgcgatcctcgccctgacggtgaagtcggccaacgacgtcgccgtcgtgctcgccgaa
gcgctgggcggcagcgaggagcagttcgccgagatgatgacggccaaggcgcaggcgctg
ggcatgaccagcaccaccttccgcaacgcctcgggcctgccgcacaaggagcagcgcacc
accgcccgcgacatggcccgcctgtcgcgcgccatcgtgtcccgcccggcgcgggaatac
gcctacttctcgcgcacgcgcttcgactggaacggcacggtggtgcccggccacaaccgg
ctgctcggccgggtggaagggtacgacggcatcaagacgggcttcatcaacctcagcggc
ttcaacctcgccggcagcgccagccgcaacggccagcggctggtcgccgtcgtcctgggc
ggcaccaccgccgcctcccgcgaccgcgaggtcgccgaactgctggagcagggcttcggt
tccgcgccgcccaagcagacggtggccgtcaccgacgtgaaggccgtccgctaa

DBGET integrated database retrieval system