KEGG   Azospirillum sp. TSH58: TSH58p_28830Help
Entry
TSH58p_28830      CDS       T05449                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
azt  Azospirillum sp. TSH58
Brite
KEGG Orthology (KO) [BR:azt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TSH58p_28830
Enzymes [BR:azt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TSH58p_28830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like AlaDh_PNT_C DAO FAD_binding_3 NAD_binding_7 Glutaredoxin Thi4 FMO-like K_oxygenase DUF3467 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AWJ87392
UniProt: A0A2S1XSI6
LinkDB All DBs
Position
TSH58_p02:1663960..1665540
Genome map
AA seq 526 aa AA seqDB search
MLDSNVKGQLKAYFDKITQPIELAASLDDGAKSQEMQALLQDIASLSDKITFVRSDDDAR
KPSFAITRTGTDIGVRFAGLPMGHEFNSLILALLQVGGHPSKESAEVIEQVKALEGEYRF
ETYFSLSCQNCPDVVQALNLMSVLNPRIKHVAIDGALFQQEVESRKIMAVPSIFLNGEPF
GQGRMGLEQILAKIDTGASQRDAEKIKAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLAAALEQHVKEYEVDVMNLQRAEKLIPASGPGG
LIEVQLANGASLKSKTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAEVTLIEFDSQLRADEVLQRKLRSLPNVRVITSGLTTEVHGDG
TKVTGLSYKNRNTGEVHRIDLEGIFVQIGLVPNTEWLKGSVALSPRGEIEVDARGQTSIP
GVFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRMAPVEAVAAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgttggatagcaacgtcaaaggccagctcaaggcctatttcgacaagatcacgcagccc
atcgaactggccgcctccctggacgacggcgcaaaatcgcaggaaatgcaggctctgctg
caggacatcgcgtccctgtcggacaagatcaccttcgtccgcagcgacgacgacgcgcgc
aagccctccttcgcgatcacgcgcaccggcaccgacatcggcgtccgcttcgccggcctg
ccgatgggccacgaattcaattccctcatcctcgccctgctgcaggtcggcggccacccc
tccaaggagtcggcggaggtcatcgagcaggtgaaggcgctggagggtgagtaccggttc
gagacctacttctcgctgtcctgccagaactgccccgacgtggtgcaggccctgaacctg
atgagcgttctgaacccgcggatcaagcatgtcgccatcgacggcgcgctgttccagcag
gaggtcgaatcgcgcaagatcatggccgtcccatccatcttcctgaacggcgagccgttc
ggccagggccgcatggggctggagcagatcctcgccaagatcgacaccggcgcctcgcag
cgcgacgccgagaagatcaaggccaaggacgccttcgacgtgctggtgatcggcggcggc
ccggccggcgccgcggcggcgatctacgcggcccgcaagggcatccgcaccggcgtcgcg
gcggaacgcttcggcggtcaggtgctcgacacgatggccatcgagaacttcatctccgtc
tcgcacaccgaggggccgaagctggccgccgcgctggagcagcacgtcaaggagtatgag
gtcgacgtgatgaacctgcagcgggcggagaagctgatccccgcgtcgggtccgggcggc
ctgatcgaggtccagctcgccaacggcgcctcgctgaagtcgaagacggtgatcctgtcc
accggtgcccgctggcgccagatgggcgtccccggcgaggatgagtaccggaacaagggc
gtggcctattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtcatc
ggcggcggcaattccggtgtcgaggcggccatcgacctcgccggcatcgtcgccgaggtg
acgctgatcgagttcgacagccagctccgcgccgacgaggttctgcagcgcaagctgcgc
agcctgcccaacgtgcgcgtcatcacgtcgggcctgacgaccgaggtgcatggcgacggc
accaaggtgaccggcctcagctacaagaaccgcaacaccggcgaggtgcaccgcatcgac
ctggaaggcatcttcgtgcagatcggcctcgtccccaacaccgagtggctgaagggctcc
gtggcgctgagcccgcgcggcgagatcgaggtggacgcgcgcggccagacctccatcccc
ggcgtgttcgcggcgggcgatgcgacgacggtgccttacaagcagatcatcatcgccatg
ggcgagggctcgaaggctgccctgtcggccttcgactacctgatccgcatggcgccggtc
gaggccgtcgccgcggcgtaa

DBGET integrated database retrieval system