KEGG   Azospirillum sp. TSH58: TSH58p_28950Help
Entry
TSH58p_28950      CDS       T05449                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
azt  Azospirillum sp. TSH58
Pathway
azt00970  Aminoacyl-tRNA biosynthesis
azt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TSH58p_28950
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:azt03029]
    TSH58p_28950
Enzymes [BR:azt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     TSH58p_28950
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     TSH58p_28950
Mitochondrial biogenesis [BR:azt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TSH58p_28950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AWJ87415
UniProt: A0A2S1XSE4
LinkDB All DBs
Position
TSH58_p02:1687675..1689126
Genome map
AA seq 483 aa AA seqDB search
MSYIQGETGDWEIVIGLEVHAQVISNAKLFSGAATAFGAEPNSQVSFVDAAFPGMLPVIN
EHCIEQAVRTGLGLKAQINLHSVFDRKNYFYADLPQGYQISQFQQPIVGKGEIVLDLPDG
SSRTVGVTRLHLEQDAGKSLHDQHPAKTYIDLNRSGVALMEIVSEPDMRTAEEAGAYVRK
LRSILRYLGTCDGNMEEGSMRCDVNVSVRKPGAPFGTRCEIKNVNSIRFVMQAIEYEARR
QIEIIEDGGKIDQETRLWDTTKFVTRSMRSKEEAHDYRYFPDPDLLPLELDADWVEGIKS
TLPELPDDKKARFISEYKLSPYDANVLVSEKARADFFEAVAKGRDPKLAANWVTGELFGY
LNKAGKEIEESPVSAENLGGLIDLIADNTISGRIAKEVFEAMFETGEKPADIVEKKGLRQ
VTDTGAIEASIDAVLAANADKVAEFRSGKDKLFGFFVGQVMKATQGKANPALVNEILMTK
LKG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacattcagggcgaaacgggcgattgggaaatcgtgatcgggctggaggtccac
gcccaggtcatttcgaacgccaagctgttctccggcgccgccaccgccttcggcgcggag
ccgaacagccaggtcagcttcgtcgacgccgcctttcccggcatgctgcccgtcatcaac
gagcattgcatcgagcaggcggtgcgcaccggcctggggctgaaggcgcagatcaacctg
cactcggtgttcgaccgcaagaattacttctacgccgacctgccgcagggctaccagatc
agccagttccagcagcccatcgtcggcaagggcgagatcgttctggacctgccggacggc
tcctcgcgcacggtcggcgtcacgcgcctgcatctggagcaggacgccggcaagtcgctg
cacgaccagcaccccgccaagacctacatcgatctgaaccggtcgggcgtggcgctgatg
gagatcgtgtcggagccggacatgcgcactgcggaggaggccggcgcctatgtgcgcaag
ctgcgctccatcctgcgctacctcggcacctgcgacggcaacatggaggaaggctccatg
cgctgtgacgtcaacgtgtcggtgcgcaagccgggcgcgcccttcggcacgcgctgcgag
atcaagaacgtcaactcgatccgcttcgtcatgcaggcgatcgagtacgaggcgcgccgc
cagatcgagatcatcgaggacggtggcaagatcgaccaggagacgcgtctgtgggacacg
accaagttcgtgacccgctccatgcgctccaaggaagaggcgcacgactaccgctacttc
cccgatcccgacctgctgccgctggagctggacgccgactgggtcgagggcatcaagagc
accctgccggaactgccggacgacaagaaggcccgcttcatcagcgagtacaagctgtcg
ccctacgacgccaacgtgctggtgtcggagaaggcccgcgccgacttcttcgaggcggtg
gccaagggccgcgacccgaagctggccgccaactgggtcaccggcgagctgttcggctat
ctgaacaaggccggcaaggagatcgaggagagccccgtttcggcggagaatctcggtggc
ctgatcgacctgatcgccgacaacaccatctctggccgaatcgccaaggaggtgttcgag
gcgatgttcgaaacgggtgagaagcccgccgacatcgtcgagaagaaggggctgcgccag
gtcaccgacaccggggccatcgaggcgtccatcgacgccgttctggccgccaacgccgac
aaggtggccgagttccggtcgggcaaggacaagctgttcggcttcttcgtcggtcaggtc
atgaaggcgacccagggcaaggccaacccggccctggtcaacgagatcctgatgaccaag
ctgaagggctga

DBGET integrated database retrieval system