KEGG   Azospirillum sp. CFH 70021: DEW08_16415Help
Entry
DEW08_16415       CDS       T05917                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
azz  Azospirillum sp. CFH 70021
Pathway
azz00020  Citrate cycle (TCA cycle)
azz00190  Oxidative phosphorylation
azz00650  Butanoate metabolism
azz01100  Metabolic pathways
azz01110  Biosynthesis of secondary metabolites
azz01120  Microbial metabolism in diverse environments
azz01130  Biosynthesis of antibiotics
azz01200  Carbon metabolism
Module
azz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
azz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:azz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DEW08_16415
   00650 Butanoate metabolism
    DEW08_16415
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DEW08_16415
Enzymes [BR:azz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DEW08_16415
    1.3.5.4  fumarate reductase (quinol)
     DEW08_16415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: AWK87591
UniProt: A0A2S2CSV1
LinkDB All DBs
Position
2:complement(2125832..2127616)
Genome map
AA seq 594 aa AA seqDB search
MATAYQIIDHTYDVVVVGAGGAGLRATFGMAEKGLKTACITKVFPTRSHTVAAQGGISAA
LGNMGDDDWRYHMYDTVKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTPEGKIYQ
RAFGGMTAEYGKKQAYRTCAAADRTGHAILHTLYQQSLKHEAEFFVEYFALDLIMEDGVC
KGVLAWNLDDGTIHRFRGQLVVLATGGYGRAYFSATSAHTCTGDGGGMVLRAGLPLQDME
FVQFHPTGIYGSGCLITEGVRGEGGYLTNSNGERFMERYAPSAKDLASRDVVSRSMTIEI
REGRGVGPHKDHIHLHLEHLPPEIIHQRLPGIAETAKIFANVDVTKEPIPVLPTVHYNMG
GIPTNFRCEVVSPTAENPDQVVPGLMAIGEAACVSVHGANRLGSNSLLDLVVFGRAAAIR
AAEIVEKGKVPGVKADSCDKALERFDRIRNAKGSIKSADLRLEMQKTMQNNCAVFRTGEV
LEEGVKLIDAVYARKDDMAISDRSLVWNSDLVEALELDNLLGQAVATLHSAQNRPESRGA
HAREDYPNRDDENWMKHTVIWVADDGKTRIDYRPVHMYTLTDEVEVFPPKARVY
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcctaccagatcatcgaccacacctatgacgtcgtcgtcgtcggcgccggc
ggcgccggcctgcgcgccaccttcggcatggccgagaaggggctgaagacggcctgcatc
accaaggtcttcccgacccgctcgcacaccgtggcggcgcagggcggcatctcggcggcg
ctcggcaacatgggcgacgacgactggcgctaccacatgtacgacaccgtgaaggggtcg
gactggctgggcgaccaggacgccatcgagtacatgtgccgcgaggccatcccggcgatc
atcgagctggagcactacggcgtgcccttctcgcgcacgccggagggcaagatctaccag
cgcgccttcggcggcatgaccgccgagtacggcaagaagcaggcctaccgcacctgcgcg
gcggccgaccgcaccggccacgccatcctgcacaccctctaccagcagtcgctgaagcac
gaggcggagttcttcgtcgagtatttcgcgctggacctcatcatggaggacggcgtctgc
aagggcgtgctggcctggaacctcgacgacggcaccatccaccgcttccgcgggcagctc
gtcgtgctggcgaccggcggctacggccgcgcctacttctcggcgacctcggcccacacc
tgcacgggtgacggcggcggcatggtgctgcgcgccggccttccgctgcaggacatggag
ttcgtgcagttccacccgaccggcatctacggctccggctgcctcatcaccgagggcgtg
cgcggcgagggcggctacctcaccaactccaacggcgagcgcttcatggagcgctatgcc
ccgtcggccaaggatctggcgtcgcgcgacgtcgtgtcccgctcgatgaccatcgagatc
cgcgagggccgcggcgtgggtccgcacaaggaccacatccacctgcacctggagcatctg
ccgccggagatcatccaccagcgcctgcccggcatcgccgagacggccaagatcttcgcc
aacgtggacgtcaccaaggagccgatcccggtcctgccgaccgtccactacaacatgggc
ggcatcccgaccaacttccgctgcgaggtcgtcagcccgaccgccgagaaccccgaccag
gtggtgcccggcctgatggcgatcggcgaggcggcctgcgtgtcggtgcacggcgccaac
cgcctgggctccaactcgctgctcgacctcgtggtgttcggccgtgcggccgccatccgc
gccgccgagatcgtcgagaagggcaaggtcccgggcgtcaaggccgactcctgcgacaag
gcgctggagcgcttcgaccgcatccgcaacgccaagggctcgatcaagtcggccgacctg
cggctggagatgcagaagaccatgcagaacaactgcgcggtgttccgcacgggcgaggtg
ctggaggagggcgtgaagctgatcgacgccgtctacgccaggaaggacgacatggcgatc
agcgaccggtcgctggtgtggaattcggaccttgtggaagcgctggagctggacaatctg
ttggggcaggcggtcgcgaccctgcactccgcgcagaaccgtccggaaagccgcggcgcc
catgcccgcgaggactatccgaaccgcgacgacgagaactggatgaagcacaccgtcatc
tgggtcgccgacgacgggaagacccggatcgactaccgtccggtccatatgtacaccctg
accgacgaggtcgaggtgttcccgcccaaggcccgcgtctactaa

DBGET integrated database retrieval system