KEGG   Azospirillum sp. CFH 70021: DEW08_16895Help
Entry
DEW08_16895       CDS       T05917                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
azz  Azospirillum sp. CFH 70021
Pathway
azz00480  Glutathione metabolism
azz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DEW08_16895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azz02000]
    DEW08_16895
Enzymes [BR:azz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DEW08_16895
Transporters [BR:azz02000]
 Other Transporters
  Pores ion channels [TC:1]
   DEW08_16895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_C_2 GST_N_3 GST_N_2 2Fe-2S_Ferredox GST_C_6 DUF1958
Motif
Other DBs
NCBI-ProteinID: AWK87665
UniProt: A0A2S2CTC2
LinkDB All DBs
Position
2:complement(2223953..2224558)
Genome map
AA seq 201 aa AA seqDB search
MKLFFKPGACSLSPHIVLREAGLPFELVNVDLAAKTLADGSDFYAVNPKGQVPALALDEG
GILTEGPVIVQYIADKVPEKGLIPPAGTLERYRVLEWLNFVGTELHKTFSPLFRPTTPDA
YKDIVRQTLAQKFAVLDKALAGRSYLTGESFTVADAYCFVVLGWARPMGIDLSAYPNVTA
FQARIAGRPAVREARAAEGLG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctttttcaagcccggcgcctgctcgctgtcgccgcacatcgtgctgcgcgag
gccgggctgccgttcgagctggtgaacgtcgacctcgccgccaagacgctcgccgacggc
agcgatttctacgccgtgaaccccaagggccaggtgccggccctggcgctggacgagggc
ggcatcctcaccgaggggccggtgatcgtgcagtacatcgccgacaaggtgccggagaag
gggctgatcccgccggccggcacgctggagcgctaccgcgtcctggagtggctgaacttc
gtcgggaccgagctgcacaagaccttcagcccgctgttccgcccgaccacgccggacgcc
tacaaggacatcgtccgccagacgctggcgcagaagttcgccgtgctggacaaggcgctg
gccggcaggtcctacctgaccggcgagagcttcacggtggcggacgcctattgcttcgtg
gtgctgggctgggccaggccgatggggatcgacctgtcggcctatccgaacgtgaccgcc
ttccaggcccgcatcgccgggcgccccgccgtccgcgaggcccgcgccgccgaggggctg
ggctga

DBGET integrated database retrieval system