KEGG   Azospirillum sp. CFH 70021: DEW08_21815Help
Entry
DEW08_21815       CDS       T05917                                 

Definition
(GenBank) hemolysin D
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
azz  Azospirillum sp. CFH 70021
Brite
KEGG Orthology (KO) [BR:azz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azz02000]
    DEW08_21815
Transporters [BR:azz02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   DEW08_21815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl Atg14 AATF-Che1 Fez1 DegS APG17
Motif
Other DBs
NCBI-ProteinID: AWK88728
UniProt: A0A2S2CW92
LinkDB All DBs
Position
unnamed1:114757..115863
Genome map
AA seq 368 aa AA seqDB search
MASNVRKIILSGVAAAVLLGGGYAGWDWWTEGRFIESTDNAYVQGDITVVSPKVSAYVRE
VRVAENQQVRTGDVLVVLDDQDFRAKVAEAEAAVAAQKAALGTLDSKLELQKALIEQAAA
TLASAEAEQRRAQQDFERTRSLASDSWTSRQKLETADADLRKAVAQVAKSRAALAAEKDQ
TDVLRATRAETEARLQQVQATLQSARNDLTNTVIHAAVDGVVGNRGVQVGQYARPGVQLL
SLVPLPDVYVVANFKETQLSRMRPGQTVTLSVDAFPGRHLEGRVESFAPASGSKFSLLPP
ENATGNFTKIVQRVPVRIAVPSDNPLTGLLRPGLSVVAEVDTRGADRQPHVAGSVFGALP
AKQAVAEK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaacgtgcggaagatcatcctgtcgggggttgccgcggccgtactgctcggc
ggcggctatgccggctgggactggtggacggaagggcgcttcatcgaatcgaccgacaac
gcctatgtccagggcgacatcaccgtcgtcagcccgaaggtctcggcctatgtccgcgag
gtgcgggtggcggagaaccagcaggtgcgcaccggcgacgtgctggtggtgctggacgac
caggacttccgcgccaaggtcgcggaggccgaggcggccgtcgccgcccagaaggcggcc
ctcggcacgctggacagcaagctggagttgcagaaggccctgatcgagcaggcggcggcc
acgctggcgagtgcggaggccgagcagcgccgcgcccagcaggatttcgaacggacccgg
tcgctggccagcgacagctggaccagccgccagaagctggagaccgccgacgccgacctg
cgcaaggcggtggcccaggtcgccaagtcgcgcgcggcgctggccgcggagaaggaccag
accgacgttctgcgggccacccgcgcggagacggaggcgaggctccagcaggtgcaggcg
acgctgcagtcggcccgcaacgacctgaccaacacggtcatccatgcggcggtcgacggc
gtcgtcggcaaccgcggcgtccaggtcgggcagtatgcccgtcccggcgtgcagctcctc
tcgctggtgccgctgcccgacgtctatgtcgtcgccaacttcaaggagacccagctctcc
cgcatgcggcccggccagaccgtcaccctgtcggtcgatgccttccccggccgccacctg
gaaggccgggtcgagagcttcgcccccgcctccggctcgaagttcagcctgctgccgccg
gagaatgcgaccggcaacttcaccaagatcgtccagcgcgtgccggtgcgcatcgccgtt
ccgtcggacaacccgctgaccggcctgctgcgccccggcctgtccgtggtggcggaggtc
gacacccgcggcgccgaccggcagccgcacgtcgccggcagcgtcttcggggcgctcccc
gccaagcaggcggtcgccgagaagtaa

DBGET integrated database retrieval system