KEGG   Brucella abortus A13334: BAA13334_I00498Help
Entry
BAA13334_I00498   CDS       T01704                                 

Definition
(GenBank) Enoyl-acyl-carrier-protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
baa  Brucella abortus A13334
Pathway
baa00061  Fatty acid biosynthesis
baa00780  Biotin metabolism
baa01100  Metabolic pathways
baa01130  Biosynthesis of antibiotics
baa01212  Fatty acid metabolism
Module
baa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:baa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BAA13334_I00498
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BAA13334_I00498
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    BAA13334_I00498
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:baa01004]
    BAA13334_I00498
Enzymes [BR:baa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BAA13334_I00498
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BAA13334_I00498
Lipid biosynthesis proteins [BR:baa01004]
 Fatty acid synthase
  Component type
   BAA13334_I00498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AEW16683
LinkDB All DBs
Structure
PDB: 

Position
1:306102..306920
Genome map
AA seq 272 aa AA seqDB search
MEGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDF
VLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVI
SAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGP
QGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSG
VTGEIHFVDSGYNIVSMPTLEELKSSDSERGE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtttgatgcaaggaaaacgcggcctcatcatgggggtcgcgaacaatcactca
ctggcctggggcattgcaaaacagctcgccgcacagggcgccgaactggccttcacctat
cagggtgatgcgctgggcaagcgcgtgaaacctcttgccgaacaggtcggctcggatttc
gtgctgccttgcgacgtggaggacatcgccaccgtcgatgccgttttcgaagaaatcgag
aagaagtggggcggtctcgatttcctcgtgcacgctatcggtttttccgacaagacggaa
ttgaagggccgctatgcagatgtcaccacgcgcgagaatttcagccgcacgatggtcatc
tccgcctattccttcacagaagtggcgcagcgcgctgaaaagctcatgaaggacggcggc
tcgatcctgacgctgacctatggcggatcgacccgaacgatccccaattacaacgtgatg
ggtgttgccaaggccgctctcgaggccatggtgcgctatcttgcagccgattacggcccg
cagggcatccgcgtcaacgcgatttccgcaggccccgtgcgcacgcttgctggcgccggg
atcggtgatgcccgcgcgattttcagctaccagcgccgcaactcgccgctgcgccgcacc
gtcgatatcgatgatgtcggcaaatcggcagtctatcttctgtccgatctttcaagcggt
gtgaccggcgaaatccatttcgttgattccggctataacatcgtttcgatgccgacgctg
gaagagctgaaaagttcggactccgaacgcggagaataa

DBGET integrated database retrieval system