KEGG   Brucella abortus A13334: BAA13334_I03043Help
Entry
BAA13334_I03043   CDS       T01704                                 

Definition
(GenBank) Superoxide dismutase (Fe)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
baa  Brucella abortus A13334
Brite
Enzymes [BR:baa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BAA13334_I03043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEW18275
LinkDB All DBs
Position
1:complement(1835026..1835826)
Genome map
AA seq 266 aa AA seqDB search
MSAKDYLPHLAGISIIFHCLEAELRHCAIAARIVAAYVDCARKFCSCIRASSICFARRKL
KEKRRVSMAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSF
EEIVKESFGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRA
DFIAAGAGQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNA
RPKYLEAFVDSLVNWDYVLEMYEKAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaagactatctgccccatcttgctgggatttcaataatatttcattgcctt
gaagctgaattgcgccattgcgccattgccgcccgcattgttgcggcttatgtagattgc
gcacgcaagttttgctcttgcatccgggcatcatctatttgctttgcccgccgcaagctt
aaagaaaagaggagagtttccatggctttcgaactgcccgcccttccgtatgactatgat
gcgcttgcgcctttcatgtcgcgcgaaacgcttgaatatcatcacgacaagcatcatcag
gcctatgttaccaacggtaacaagcttctcgaaggttccggcctggaaggcaagagcttc
gaagaaatcgtcaaggaaagcttcggcaagaatcaggccctcttcaacaatgccggccag
cactacaaccatatccatttctggaaatggatgaagaaggatggcggcggcaagaaactg
ccgggcaagctggaaaaggcctttgattccgatcttggcggttatgacaagttccgcgct
gatttcatcgctgccggtgccggccagttcggttcgggctgggcctggctttccgtcaag
gacggcaagcttgaaatttccaagaccccgaacggtgaaaacccgctcgtgcacggtgcg
gcgccgatcctcggcgtggatgtgtgggaacactcctattacatcgattaccgcaacgcg
cgtccgaaatatctcgaagctttcgtcgatagcctcgtgaactgggattacgtgctggaa
atgtacgaaaaggcggcataa

DBGET integrated database retrieval system