KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp_172Help
Entry
bbp_172           CDS       T00111                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
bab03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    bbp_172 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bab03400]
    bbp_172 (ung)
Enzymes [BR:bab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     bbp_172 (ung)
DNA repair and recombination proteins [BR:bab03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     bbp_172 (ung)
 Prokaryotic type
     bbp_172 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AAO26905
UniProt: P59465
LinkDB All DBs
Position
197551..198225
Genome map
AA seq 224 aa AA seqDB search
MDNRTLLNWSSILKNEKKKYYFINIINHLFFERQKKMIFPPKGKVFNAFVHTQLYDIKVV
ILGQDPYYKINQAHGLAFSVENIVKFIPSSLKNIQKEIISDLGQNRSFSHGCLTKWALQG
VFLLNSVLTVEAGKPGSHYKLGWERFTNKVISIINEYCKGVVFLLWGSYAQKKICLIDRT
RHYILLAPHPSPLSAYRGFFGCRHFSKTNKILKQQNKSPINWFF
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggataatcgtacattattaaattggtctagtatattaaaaaatgaaaaaaaaaaatat
tattttattaatataataaatcatcttttttttgaacgtcaaaaaaagatgattttcccg
cctaaaggaaaggtatttaatgcttttgtacatacacaattgtatgatataaaagtggta
atacttggacaagatccttattataaaataaatcaggcgcatggtttggctttttctgtt
gaaaatatagtaaaatttattccttcgtctttaaaaaatattcaaaaagaaataattagt
gatttaggtcaaaatcgctcattttcgcatggttgtttaacaaaatgggcgttacaaggg
gtttttttattaaattcagttttaacagtggaggctggtaaacctggatctcactataag
ttaggttgggaacgttttactaataaggttattagtattattaatgaatattgtaaaggt
gtagtatttttgttatggggttcatatgctcaaaaaaaaatatgtttaatagatagaact
cgacattatattttgttagcgccgcatccatcaccattatcagcttatcgaggatttttt
ggatgccgccatttttcaaaaacaaacaaaatactcaaacaacagaacaaaagtcctatt
aattggtttttttaa

DBGET integrated database retrieval system