KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp_196Help
Entry
bbp_196           CDS       T00111                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
bab00550  Peptidoglycan biosynthesis
bab01100  Metabolic pathways
bab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bbp_196 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    bbp_196 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    bbp_196 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bab01011]
    bbp_196 (ddlB)
Enzymes [BR:bab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     bbp_196 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:bab01011]
 Precursor biosynthesis
  Amino acid ligase
   bbp_196 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 TTL ATP-grasp_3 ATP-grasp GARS_A ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AAO26928
UniProt: P59435
LinkDB All DBs
Position
complement(228840..229769)
Genome map
AA seq 309 aa AA seqDB search
MTIITEKIAVLLGGTSQERNISLISGYNILNSLLKSGIHAVAIDTKDFPITQLPHQKFTK
AFIALHGRDGEDGTIQSVLKYLNIPFTGSKTLPSAISINKFKTKLLWQSFNLPVVPYLHI
NKHEFNKKFLQKFKKNISLLGLPIIVKPNQEGSSIGITIVYSYETLYKACKTAFIFDNSI
LIEKFIYGEEYTISILGKKILPIIRICPENTFYNYNSKYLSNRTTYFCPSGLNKLKELEL
KKITLTAWNIIDGTGWGRVDVIMDYKNKFWLLEANTCPGMTDHSLFPMSAKKAGISYQIL
VQKILELAN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcataactgaaaaaatagctgttcttttaggtggaacatctcaagaaagaaat
atatcattaatatctggttacaatatattaaatagtcttttaaaatctggaattcatgct
gtggctatagacaccaaagattttcctattacacaattacctcatcaaaaatttacaaaa
gcatttatagctttacatggacgagatggagaagatggtacaatacaaagcgtactaaaa
tatttaaatattccttttacaggaagtaaaacgttaccttcagctatttcaattaataaa
tttaaaacaaaattattatggcaaagttttaatttacctgttgttccttatttacacatt
aataaacatgaattcaataaaaaatttttacaaaaatttaaaaaaaatatttcactttta
ggattacctataattgtaaaacccaaccaagaaggatcgagtataggtattacaattgta
tattcatatgaaaccttatataaagcatgtaaaacagcttttatatttgataattcaata
ttaattgaaaaatttatatatggagaagaatatacaattagcatcttgggaaaaaaaata
cttccaattatacgaatatgtcctgaaaataccttttacaattacaattctaaatattta
tccaaccgaacaacatatttttgtccaagcggcttaaataaactaaaagaattagaacta
aaaaaaattactctaacagcatggaatattatagatggaactggatggggaagagttgat
gtaataatggattacaaaaataaattctggttattagaagcaaatacatgtcctgggatg
actgatcatagcttatttccaatgtcggcaaaaaaagcaggtatatcttatcaaatacta
gtacaaaaaattttagaactagctaattaa

DBGET integrated database retrieval system