KEGG   Buchnera aphidicola Bp (Baizongia pistaciae): bbp_526Help
Entry
bbp_526           CDS       T00111                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
bab  Buchnera aphidicola Bp (Baizongia pistaciae)
Pathway
bab00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bab01100  Metabolic pathways
bab01110  Biosynthesis of secondary metabolites
bab01130  Biosynthesis of antibiotics
bab01230  Biosynthesis of amino acids
bab02024  Quorum sensing
Module
bab_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    bbp_526 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    bbp_526 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    bbp_526 (trpE)
Enzymes [BR:bab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     bbp_526 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AAO27228
UniProt: Q89A29
LinkDB All DBs
Position
complement(589611..591179)
Genome map
AA seq 522 aa AA seqDB search
MKKNLISIDVFLTETRYQPNPTAIFNQICKKKSETLLLESAEINKKHHLESMMIIDAALK
ISFLNQIVIVEALTKNGVNLLSVFKSLLPKNVIILSDNNPLEIKFPILSMYLDEDQRLRS
LSVFDAIRFLIKSVKNLSEFAPKSMFFGGLFSYDLITSFENLPILNTHQHCPDFCFYLSE
TLLILDHKNKTSIVQVTSFTNDNFEKKRLKDRLEILKNKLSKNLCPIKFDTLKNMKLWCN
KTDEEYNKIIVNVKKFILQGEIFQVVPSRKFYLSCVNPLSSYEVLKKNNPSPYMFFMQDR
KFTLFGASPESALKYDINSRQIEIYPIAGTRPRGRRSDGSLDLDLDNRIELEMRTNNKEL
AEHLMLVDLARNDLAKICEPGTRHVADLIRVDRYSHVMHLVSRVIGKLRFDLDFLHAYQA
CMNMGTLTGAPKVRAMELISEIEGEKRGSYGGAIGYFTGLGMLDTCIVIRSAYVENKIAT
IQAGAGIVLDSVPQLESDESKNKAKAVIQAIANSHSCQIEYL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatctaataagtatagatgtatttttaacagagactcgttatcaaccaaat
cctactgctatttttaatcaaatatgcaaaaagaaatcagaaacattattactagaatcc
gcagaaattaataaaaagcatcatttagagagtatgatgattatagatgctgcattaaaa
atttcatttttgaatcaaatagttattgtagaggcattaactaaaaatggtgttaattta
ttgtctgtttttaaatctttattacctaaaaatgttattatactatcagataataatcca
ttagaaataaaatttccaattttatctatgtatttagatgaagatcagcgattacggtca
ctatctgtatttgatgcaataagatttttaattaaaagtgttaaaaatcttagcgaattc
gccccaaaatctatgtttttcggaggtttgttttcgtatgatttaattaccagttttgaa
aatttaccaatattaaatactcatcaacactgtcctgatttttgtttttatctttctgaa
acattattaatattagatcataaaaataaaacatctatcgttcaagtcacttcatttact
aatgataattttgaaaaaaagaggttaaaggatagattagaaattttgaaaaataaatta
tctaaaaatttgtgccctataaaatttgatacgctaaaaaacatgaaattatggtgtaat
aaaacagacgaagaatacaataaaattattgttaatgtaaaaaaatttattttacaagga
gaaatttttcaagtagtaccatcgagaaaattttatctttcttgtgtgaatccattgtct
tcatatgaagttttaaaaaaaaataatcctagtccatatatgttttttatgcaagatcga
aagtttactttgtttggagcttctcctgaaagtgctttaaaatatgatataaattctagg
caaattgaaatatatcctatcgctggtactagacctcgaggtagacgatctgatggatcg
ttggatttagatttagataatcggatagaattagaaatgcggaccaataataaagagttg
gctgaacatctaatgttagtagatttagctcgcaatgatttagctaaaatttgcgaacca
ggaacacgtcatgtagcagatttaattagagttgatcgttattcgcatgtcatgcattta
gtatcaagagttattggaaaattgcgttttgatttagattttttacatgcatatcaagca
tgcatgaatatggggacactaactggtgctcctaaagtgcgagctatggaattaatttca
gaaattgaaggcgaaaagagggggagttatggaggcgcgataggatatttcactggttta
ggtatgttagatacttgtattgtaattcgttctgcgtatgttgaaaataaaatagcaact
attcaagctggagctggaatagtattggattctgtacctcaattggaatcagatgagagt
aaaaataaagctaaagcagttattcaagctatagctaattcgcattcttgtcagatagag
tatttgtga

DBGET integrated database retrieval system