KEGG   Brucella abortus BDW: DK48_1670Help
Entry
DK48_1670         CDS       T03462                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
babb  Brucella abortus BDW
Pathway
babb00061  Fatty acid biosynthesis
babb00780  Biotin metabolism
babb01100  Metabolic pathways
babb01130  Biosynthesis of antibiotics
babb01212  Fatty acid metabolism
Module
babb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:babb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DK48_1670
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DK48_1670
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DK48_1670
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:babb01004]
    DK48_1670
Enzymes [BR:babb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DK48_1670
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DK48_1670
Lipid biosynthesis proteins [BR:babb01004]
 Fatty acid synthase
  Component type
   DK48_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AIJ52838
UniProt: A0A4Q2T3X6
LinkDB All DBs
Position
1:complement(1687004..1687822)
Genome map
AA seq 272 aa AA seqDB search
MTAQSGLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELG
AFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTM
LISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDL
GPQNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIDEVGDVGLYFLSDLS
RSVTGEVHHADSGYHVIGMKAVDAPDISVVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagtctggtttgttgcagggcaagcgtggattgattctaggcgtggccaat
aatcgctctatcgcttggggcattgcaaaagccgcccgtgaagctggcgcagagcttgca
ttcacctatcagggtgacgcattgaagaagcgtgtggagccgctggccgaggagcttggc
gccttcgtcgccggacattgcgacgtcgccgatgcggcgagcatcgatgcggtttttgaa
acgcttgagaagaagtggggcaagctcgacttcctggtgcacgcaatcggtttctccgac
aaggacgagctgaccggccgctatatcgatacgtcggaagccaatttcaccaatacgatg
ctgatttcggtctattcgctgacggcggtttcgcgccgcgcggaaaagctgatggccgat
ggcggatcgattctgacgctgacctattacggcgctgaaaaggtcatgccgaattacaat
gtcatgggcgtggccaaggcagcccttgaggcgagcgtgaaatatctggccgtcgatctt
ggcccccagaacattcgcgtcaatgcaatctcggctggccccatcaagacgcttgccgct
tccggcattggtgacttccgctatatcctgaagtggaacgaatataatgcgccgctgcgc
cgcaccgtcacgatcgacgaggtgggtgatgtcggcctttatttcctttcggacctgtcg
cgttcggttacaggcgaagtgcaccatgccgacagcggctatcatgtcattggcatgaaa
gcggttgacgcaccggatatctcggtcgtgaaagactga

DBGET integrated database retrieval system