KEGG   Brucella abortus BDW: DK48_2152Help
Entry
DK48_2152         CDS       T03462                                 

Definition
(GenBank) ABC transporter family protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
babb  Brucella abortus BDW
Brite
KEGG Orthology (KO) [BR:babb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:babb02000]
    DK48_2152
Transporters [BR:babb02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    DK48_2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 ATP_bind_1 AAA_22 AAA_27 AAA_16 AAA_30 AAA_25 SbcCD_C AAA_15 AAA_24 ABC_ATPase RsgA_GTPase AAA_5 Zeta_toxin DUF3584 AAA_33
Motif
Other DBs
NCBI-ProteinID: AIJ50989
LinkDB All DBs
Position
2:50406..51164
Genome map
AA seq 252 aa AA seqDB search
MIEISQVSKSYNGTLVVDDVTLRLPARGITSIIGPNGAGKSTLLSMVSRLLPMDKGSVTV
DGLDITTTSGDVLARRLSILRQENAINSRLTVRDLVTFGRYPYSKGRPNSEDRKHVEQAI
GYLGLEGLSERFLDELSGGQRQRAFVAMVLCQDTDYVLLDEPLNNLDMKHSASMMKLLRR
AADELGKTIVLVLHDINFASCYSDHIVAMRHGKVVHQGSPDELIHPEILGEIYEMEIGVE
IIGGKRIGVYYL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaaataagccaggtcagcaaatcctataacggcacactcgtcgtcgatgatgta
acgctgcgcttgcccgcacgcggaatcacatcgatcatcgggcccaatggcgccggaaag
tccaccctgctttcaatggtgagccgcctcctgcccatggacaagggcagcgtgaccgtg
gacgggctggatatcaccaccacgtcgggtgatgtgctggccaggcggctttccatcctg
cggcaggaaaacgccatcaattcgcgcctcaccgtgcgcgatctcgtgactttcgggcgc
tatccctattccaaaggacgtcccaacagcgaagaccgcaagcatgtggaacaggctatc
ggctatcttggccttgaaggtttgagcgaacgttttctggacgagctttccggcggccag
cgccagcgcgcctttgtggcgatggtgctgtgccaggatacggattacgttctgctggac
gaaccgctcaacaatctcgatatgaagcattccgcctcgatgatgaagcttctgcgccgc
gctgccgatgaactgggaaagaccatcgttctcgtgctgcacgacatcaattttgcgtcg
tgctattcagatcatatcgttgccatgcgccacggcaaggtcgtgcatcagggaagcccg
gatgaactcatccatccggaaattctcggcgaaatctatgagatggaaatcggcgtcgaa
atcatcggcggcaagcgcataggcgtctattatctctag

DBGET integrated database retrieval system