KEGG   Brucella abortus BDW: DK48_2193Help
Entry
DK48_2193         CDS       T03462                                 

Definition
(GenBank) bacterial extracellular solute-binding family protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
babb  Brucella abortus BDW
Pathway
babb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:babb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DK48_2193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:babb02000]
    DK48_2193
Transporters [BR:babb02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    DK48_2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1 DUF1521
Motif
Other DBs
NCBI-ProteinID: AIJ51149
UniProt: A0A4Q2T8A8
LinkDB All DBs
Position
2:complement(96169..97194)
Genome map
AA seq 341 aa AA seqDB search
MRSAFMVAALAAGVSSFAFSAQAAGNLNLICSADVVICEQMKNMFEKDTGIKVNMVRLSS
GETYAKVRAEARNPKTDIWWAGTGDPHLQAASEGLTLEYKSPMLDQLNDWAKKQAESSGF
RTVGVYAGALGWGYNTDIFAKKNLKEPKCWADLLDPSYKGEIQMANPNSSGTAYTALATL
VQIMGEDKAFDYLKKLNANVSQYTKSGSAPVKSAARGETGIGIVFMHDAVAMTADGFPIK
SVAPCEGTGYEIGSMSIIKGAKNLENAKKWYDWALTAEVQSHMKDAKSFQLPSNKSAEVP
KESPRFEDIKLIDYDFKTYGEPAKRKELLERWDKEVGAVAN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcagcattcatggttgcggcgctggccgctggggtatcgtcattcgcattctcg
gcccaggctgccggcaatctcaaccttatctgttcggcagatgtcgtcatctgcgaacag
atgaaaaatatgttcgagaaagataccggaatcaaggtcaatatggtgcgcctttcttcc
ggcgaaacctatgcgaaagtgcgtgccgaagcgcgcaatccgaagaccgatatctggtgg
gcaggcacgggcgacccgcaccttcaggccgcttccgaagggctgacgcttgaatataaa
tcgccgatgctcgaccagttgaatgattgggccaaaaaacaggctgaaagttccggcttc
cgcacggtcggggtttatgccggtgcgctgggctgggggtataacaccgatattttcgcc
aagaagaacctgaaggaaccgaagtgctgggccgatctcctggacccttcttataagggc
gaaatccagatggccaatccgaattcttccggcacggcctatacggcgcttgccacgctg
gttcagatcatgggtgaggacaaagcctttgattatctgaagaaactcaacgccaatgtc
tcgcaatataccaagtccggttctgcgcctgtgaagtctgcggcgcgcggtgaaacgggc
atcggcatcgtcttcatgcatgatgcggtggcgatgacggcggacggtttccccatcaag
tctgtcgcgccatgcgaaggcacaggctatgaaatcggctcaatgtccatcatcaagggc
gcgaagaaccttgaaaacgccaagaaatggtatgactgggcgctgaccgccgaggtgcag
tcgcatatgaaggacgccaagtccttccagcttccctccaacaagtctgccgaggttcca
aaggaatcgccgcgctttgaggatatcaagctcatcgattacgatttcaagacttatggc
gaaccggccaagcgcaaggaattgctggagcgctgggacaaggaagtcggcgcagtcgcc
aactga

DBGET integrated database retrieval system