KEGG   Brucella abortus BDW: DK48_647Help
Entry
DK48_647          CDS       T03462                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
babb  Brucella abortus BDW
Pathway
babb00480  Glutathione metabolism
babb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:babb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DK48_647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:babb02000]
    DK48_647
Enzymes [BR:babb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DK48_647
Transporters [BR:babb02000]
 Other Transporters
  Pores ion channels [TC:1]
   DK48_647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AIJ53098
LinkDB All DBs
Position
1:658689..659300
Genome map
AA seq 203 aa AA seqDB search
MLTIYSQPDSGNCYKPRLLLAKLGKPFRHVTVSALDGSTRTPEYLARNPNGKVPLLELED
GRFLAESNAILLYLAEGTRFLPVDPYERALVYQWLFFEQYSHEPYIAVRRALKIYPERAG
DATPERLAATLAGGEKALSVMDVQLRKTPFIAGDHYTVADIALYAYTHEAHLGGFDMQKY
RAVGDWLERVAADKGHVPIDWLP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccatctattcgcagcctgattctggcaattgctacaagccgcgccttctgctg
gcgaaacttggcaagccgttccgtcatgtgacggtttcggcgctggatggatcgacgcgc
acgcctgaataccttgccaggaacccgaatggaaaagtgccgttgctggagttggaggac
ggacgctttctggccgaatcaaacgccatcctgctgtatctggcggaggggacgcgcttc
ctgccggtcgatccttatgagcgggctttggtctatcaatggctgtttttcgagcaatat
agccacgaaccctatatcgccgtgcgtcgcgctttgaagatctatcctgaacgggccggt
gacgcgacaccggagcggcttgccgccacgctggcgggtggtgaaaaggcactttccgtt
atggacgtgcaactcaggaagacgccattcatcgccggtgatcattatacggtggctgac
attgcgctctatgcctatacgcatgaagcgcatcttggcggtttcgatatgcagaaatat
cgcgctgtgggcgactggctggaacgggtagcagccgacaagggccatgtgccgatcgac
tggctcccgtaa

DBGET integrated database retrieval system