KEGG   Brucella abortus NCTC 10505: DO78_1748Help
Entry
DO78_1748         CDS       T03686                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
babc  Brucella abortus NCTC 10505
Pathway
babc00020  Citrate cycle (TCA cycle)
babc00190  Oxidative phosphorylation
babc00650  Butanoate metabolism
babc01100  Metabolic pathways
babc01110  Biosynthesis of secondary metabolites
babc01120  Microbial metabolism in diverse environments
babc01130  Biosynthesis of antibiotics
babc01200  Carbon metabolism
Module
babc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
babc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
babc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:babc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DO78_1748
   00650 Butanoate metabolism
    DO78_1748
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DO78_1748
Enzymes [BR:babc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DO78_1748
    1.3.5.4  fumarate reductase (quinol)
     DO78_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AIJ57229
LinkDB All DBs
Position
1:complement(1772533..1773312)
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSRMQEGKTWPRPDGATRVTEFRIYRWSPDDDENPRIDTYYVDRDDCGPMVL
DGLLYIKNKIDPTLTLRRSCREGICGSCAMNIDGANTLACTKGMDDIKGTIKVYPLPHMP
VVKDLVPDLNNFYAQHRSIEPWLKTVSPEPQKEWLQSHEDRQKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgcacttcccaagaattcccgtatgcaggagggcaagacctggccccgt
cctgatggcgccacccgtgtcacggaattccgcatctatcgctggtcgccggatgacgac
gaaaatccgcgtatcgatacctattatgtcgatcgtgacgattgtggtccgatggttctg
gacggtctgctctatatcaagaacaagatcgacccgacgctgacgctgcgccgttcgtgc
cgtgaaggcatttgcggttcctgcgccatgaatatcgatggcgcgaacacgcttgcctgc
accaagggtatggacgacatcaagggcaccatcaaggtctatccgctgccgcatatgccg
gtggtgaaggatcttgtgccggacctcaataatttctacgcccagcaccgttccattgag
ccatggctcaagacggtttcgccggagccgcagaaggaatggctgcaaagccatgaggac
cgccagaagctcgatggtctttatgagtgcattctgtgcgcctgctgctcgacctcatgc
ccgagctattggtggaacggcgaccgttatcttggccccgccgtgctgcttcaggcctat
cgctggctgatcgattccagagacgaagccaagggcgaacgcctcgataaccttgaggat
ccgttccggctttatcgctgccatacgatcatgaattgcgcccagacctgcccgaagggt
ctgaacccggccaaggcgattgccgaaatcaagaagatgatggtcgagcgccgcgtgtaa

DBGET integrated database retrieval system