KEGG   Brucella abortus NCTC 10505: DO78_1868Help
Entry
DO78_1868         CDS       T03686                                 

Gene name
accA
Definition
(GenBank) acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
babc  Brucella abortus NCTC 10505
Pathway
babc00061  Fatty acid biosynthesis
babc00620  Pyruvate metabolism
babc00640  Propanoate metabolism
babc01100  Metabolic pathways
babc01110  Biosynthesis of secondary metabolites
babc01120  Microbial metabolism in diverse environments
babc01130  Biosynthesis of antibiotics
babc01200  Carbon metabolism
babc01212  Fatty acid metabolism
Module
babc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:babc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DO78_1868 (accA)
   00640 Propanoate metabolism
    DO78_1868 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DO78_1868 (accA)
Enzymes [BR:babc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     DO78_1868 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     DO78_1868 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: AIJ58611
UniProt: A0A4Z1PPM7
LinkDB All DBs
Position
1:1893181..1894134
Genome map
AA seq 317 aa AA seqDB search
MYNYLDFEKPVADLEGQILELKKLAQEQGSVEMGDEISRLEKRSADALKDIYRKLTPWQK
AQIARHPDRPHCLEYIDRLFTEFTPLAGDRKFANDEALQAGFGRFNGTPVAIIGQEKGSD
TKTRLKHNFGSARPEGYRKAVRIMEMADRFQLPLITFVDTAGAYPGVSAEERGQAEAIAR
STAECLKLRVPVISIIIGEGGSGGAIAIAVANRVYMLEHSIYSVISPEGAASILWHDSTR
AKDAASNMRITAQDLFDLKIIDGIIPEPLGGAHRGKESVIDATGDIIAASLRSMKDIDGE
TLKQERRQKFLEIGRNI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtataactatctcgattttgaaaaacccgtcgccgacctcgaaggccagattcttgag
ctgaaaaaactcgcgcaggaacagggcagcgtcgagatgggcgacgagattagccgcctc
gagaaacgctcggccgatgcgctgaaggatatctaccgcaagctgacgccctggcagaag
gcgcagatcgcccgccatccggaccgtccgcattgccttgaatatatcgaccggcttttc
accgaattcacgccgcttgccggcgaccgcaaattcgccaatgatgaagcccttcaggct
ggtttcggccgtttcaacggcacgcctgtcgccattatcgggcaggaaaagggttccgac
accaagacccgcctcaagcataatttcggctcggcccggccggaaggctatcgcaaggcc
gtccgcatcatggaaatggccgaccgcttccagcttccgcttatcaccttcgtggatacg
gcaggcgcctatccgggcgtcagcgccgaagagcgcggccaggcggaagccattgcccgc
tccaccgccgaatgcctcaagctgcgcgtgccggtgatctcgatcatcatcggcgaaggc
ggctccggcggcgccatcgccattgcggtggcaaaccgcgtctatatgctggaacattcg
atctattcggtcatctcaccggaaggggcagcgtcgatcctgtggcatgattccacccgt
gccaaggatgccgcctccaacatgcgcattaccgcgcaggatttgttcgatctcaagatc
atcgacggcatcattcctgaaccgctcggtggtgcgcatcgcggcaaggaatccgtgatc
gacgccacgggcgacatcattgccgcctcgctgcgctccatgaaggatatcgacggtgaa
acgctgaaacaggaacgccgccagaagttcctggaaattggtcgcaacatctga

DBGET integrated database retrieval system