KEGG   Brucella abortus bv. 2 86/8/59: DK55_1165
Entry
DK55_1165         CDS       T03321                                 

Gene name
tsf
Definition
(GenBank) translation elongation factor Ts
  KO
K02357  elongation factor Ts
Organism
babo  Brucella abortus bv. 2 86/8/59
Brite
KEGG Orthology (KO) [BR:babo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:babo03012]
    DK55_1165 (tsf)
   03029 Mitochondrial biogenesis [BR:babo03029]
    DK55_1165 (tsf)
Translation factors [BR:babo03012]
 Eukaryotic type
  Elongation factors
   DK55_1165 (tsf)
 Prokaryotic type
   DK55_1165 (tsf)
Mitochondrial biogenesis [BR:babo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DK55_1165 (tsf)
SSDB
Motif
Pfam: EF_TS UBA DUF1615 Ribosomal_L12
Other DBs
NCBI-ProteinID: AIJ93656
LinkDB
Position
1:complement(1177522..1178439)
AA seq 305 aa
MSISASLVKELRDLTGAGMMDCKAALAATEGKIEAAVDWLRAKGIAKADKKAGRTAAEGL
VGVAASGNKAVVVEVNSETDFVARNDAFQELVRKIAQAALSTDGSSEAVANANVDGKTVT
EAAKDAVATIGENISFRRSAALSVPQGVVATYIHNGVADGLGKLGVLVAIETAGDAEAAQ
AFGRQVAMHVAAVNPLALTSADVNPEAAEREKAIFIDQARQSGKPDNIIEKMVEGRMRKF
YEEVVLLSQAFVINPDLTVEAALKDAEKAIGAPAKITGFARIALGEGIEKEESDFAAEVA
AAAKG
NT seq 918 nt   +upstreamnt  +downstreamnt
atgagcatttccgcatctctcgtcaaagaactccgcgacctcaccggcgctggtatgatg
gactgcaaggcggctctcgctgctaccgagggcaagatcgaagctgccgttgactggctg
cgcgccaagggcatcgccaaggccgacaagaaggctggccgcacggctgccgaaggtctg
gtcggtgttgctgcttccggcaacaaggccgttgtcgttgaagtcaattccgaaaccgac
ttcgttgcccgcaacgacgctttccaggaactcgttcgcaagatcgcgcaggctgcgctt
tcgaccgatggttcgagcgaagccgtggccaacgccaatgtggacggcaagaccgttacc
gaagctgccaaggacgctgttgccaccatcggtgaaaacatcagcttccgccgttcggcc
gcactctcggttccgcagggcgttgttgcgacctatatccacaatggcgttgccgatggc
cttggcaagcttggcgttctggttgccattgaaacggctggcgatgcagaagccgcgcag
gctttcggacgtcaggtcgccatgcatgttgccgccgtcaatccgctggcgctgacctct
gccgacgtgaacccggaagctgccgaacgcgaaaaggcaatcttcatcgatcaggcccgc
cagtcgggcaagccggacaacatcatcgaaaagatggtggaaggccgtatgcgcaagttc
tacgaagaagttgttcttctctcgcaggctttcgtcatcaatccggacctgacggttgaa
gccgctctcaaggatgccgaaaaggctatcggtgcaccggccaagatcaccggctttgcc
cgtattgctctgggtgaaggcattgaaaaggaagaaagcgacttcgcagccgaagtggcc
gcagccgccaagggctga

DBGET integrated database retrieval system