KEGG   Brucella abortus bv. 2 86/8/59: DK55_1235
Entry
DK55_1235         CDS       T03321                                 

Gene name
fusA
Definition
(GenBank) translation elongation factor G
  KO
K02355  elongation factor G
Organism
babo  Brucella abortus bv. 2 86/8/59
Brite
KEGG Orthology (KO) [BR:babo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:babo03012]
    DK55_1235 (fusA)
   03029 Mitochondrial biogenesis [BR:babo03029]
    DK55_1235 (fusA)
Translation factors [BR:babo03012]
 Eukaryotic type
  Elongation factors
   DK55_1235 (fusA)
 Prokaryotic type
   DK55_1235 (fusA)
Mitochondrial biogenesis [BR:babo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DK55_1235 (fusA)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    DK55_1235 (fusA)
SSDB
Motif
Pfam: GTP_EFTU EFG_IV EFG_III EFG_C GTP_EFTU_D2 RF3_C MMR_HSR1
Other DBs
NCBI-ProteinID: AIJ92894
LinkDB
Position
1:complement(1239883..1241967)
AA seq 694 aa
MAREYKIEDYRNFGIMAHIDAGKTTMTERILFYTGKNHKIGETHDGASTMDWMEQEQERG
ITITSAATTTFWQGRDGKKRRFNIIDTPGHVDFTIEVERSLRVLDGAIALLDANAGVEPQ
TETVWRQAEKYHVPRMVFVNKMDKIGADFYRSVEMVGSRLGAVALPVQLPIGAENDFVGV
VDLIEMKALTWDGTIGAPATVGEIPADMADKAEEYREKLIELAVEIDEAAMEAYLEGTMP
TNDELRALIRKGTIEVKFHPILCGTAFKNRGVQPLLDAVVEFLPAPTDVPAIKGIDVKTE
TETTRESSDEAPLSMLAFKIMNDPFVGSLTFARIYSGKLTKGVSLENTVKGKRERIGRML
QMHSNSREDIDEAFAGDIVALAGLKETTTGDTLCDPLKPVILERMEFPDPVIEIAIEPKT
KADQEKMGIALNRLAAEDPSFRVKSDEESGQTIIAGMGELHLDILVDRMKREFKVEANVG
APQVAYRESITRAAEIDYTHKKQSGGSGQFARVKIIFEPHDGDDFIFESKIVGGSVPKEY
IPGVQKGIESVMGAGPLAGFPMLGVKATLIDGAYHDVDSSVLAFEIASRAAFREGAQKAG
AQLLEPIMKVEVVTPEDYVGDVIGDLNSRRGQISGTEARGIAAVVNAMVPLANMFGYVNS
LRSMSQGRAQYTMQFDHYEPVPTAVAQEIQKKFA
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggcccgcgaatataaaatcgaagactaccgcaatttcggtatcatggctcacatcgac
gccggcaagacgacgatgaccgagcgcattctgttctataccggtaagaaccacaagatc
ggcgaaacccacgatggtgcgtcgaccatggactggatggagcaggagcaggaacgcggt
atcacgatcacctctgctgctacgaccacgttctggcagggccgtgatggtaagaagcgc
cgcttcaacatcatcgacacgcctggccacgttgacttcacgattgaagttgagcgttcg
ctgcgtgtgctcgacggcgcgattgcgctgctcgacgccaatgctggcgttgagccccag
accgaaaccgtgtggcgtcaggctgaaaagtaccacgtcccgcgcatggtcttcgtcaac
aagatggacaagatcggtgccgacttctaccgctcggtggagatggttggttcgcgcctt
ggtgctgtggcacttccggttcagctgccgatcggcgctgaaaacgatttcgtcggtgtc
gtcgatctgatcgaaatgaaggccctgacctgggatggcaccatcggcgctccggcaacg
gttggtgaaattccggccgatatggcggacaaggctgaagaatatcgtgaaaagcttatc
gagcttgctgtcgagatcgatgaagcagcgatggaagcctatctcgaaggcaccatgcct
acgaatgacgagctgcgcgctctgatccgcaagggcacgatcgaagtcaagttccatccg
atcctttgcggtaccgcgttcaagaaccgtggcgttcagccgcttctcgacgctgttgtg
gaattccttccggctccgaccgacgtgcctgccatcaagggtatcgacgtcaagacggaa
accgaaaccacccgtgaatcttcggatgaagcaccgctttcgatgctggcattcaagatc
atgaacgatccgttcgttggttcgctgaccttcgcccgcatctattcgggcaagctgacc
aagggcgtttcgcttgaaaacaccgtcaagggcaagcgtgagcgtatcggccgtatgttg
cagatgcactccaacagccgtgaagacatcgatgaagctttcgcaggcgacatcgtggcc
ttggctggcctcaaggaaaccaccactggcgatacgctttgcgatccgctgaagccggtt
atcctggagcgcatggaattccctgatccggttatcgaaatcgctatcgagccgaagacc
aaggccgaccaggaaaagatgggcattgcgctcaatcgtctggctgccgaagatccttct
ttccgcgtcaagtcggacgaagagtccggtcagaccatcatcgccggcatgggcgaactt
cacctcgacattctcgtcgatcgcatgaagcgcgaattcaaggttgaagccaacgtcggc
gctccgcaggttgcataccgtgaatcgatcacccgcgctgcggaaatcgattacacccac
aagaagcagtcgggtggttcgggtcagttcgctcgcgtgaagatcatctttgaacctcat
gacggcgacgatttcatctttgaatcgaagatcgtcggcggctcggttccgaaggaatat
attccgggtgtccagaagggtatcgaaagcgtcatgggtgcgggtccgctcgcgggcttc
ccgatgctcggcgtgaaggctaccctgatcgacggcgcgtaccatgacgttgactcgtct
gttctcgcctttgaaatcgcgtcccgtgcagcgttccgtgaaggtgcgcagaaggctggc
gcccagcttctcgagccgatcatgaaggtcgaggttgtgacgccggaagattacgtcggc
gacgttatcggcgatctgaattcccgtcgcggtcagatttccggcaccgaagcccgcggc
attgccgcggtcgtcaatgcaatggttccgctcgccaacatgtttggctacgtgaacagc
ttgcgttcgatgtcccagggccgtgcacagtacacgatgcagttcgaccattatgagccg
gttccgacggcggtcgcacaggaaatccagaagaagtttgcgtaa

DBGET integrated database retrieval system