KEGG   Brucella abortus bv. 2 86/8/59: DK55_1674
Entry
DK55_1674         CDS       T03321                                 

Gene name
efp
Definition
(GenBank) translation elongation factor P
  KO
K02356  elongation factor P
Organism
babo  Brucella abortus bv. 2 86/8/59
Brite
KEGG Orthology (KO) [BR:babo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:babo03012]
    DK55_1674 (efp)
Translation factors [BR:babo03012]
 Prokaryotic type
  Elongation factors
   DK55_1674 (efp)
SSDB
Motif
Pfam: Elong-fact-P_C EFP_N EFP
Other DBs
NCBI-ProteinID: AIJ92524
LinkDB
Position
1:1689054..1689614
AA seq 186 aa
MKINGNEIRPGNVIEHEGGLWVAVKTNAVKPGKGGAYNQVELKNLINGTKLNERFRAAES
VERVRLEQKDFSFLYEQGEALIFMDTETYEQLELQKDFVGDRAAFLQDGMMVTVELYEEK
PIGIRLPDQVTLAITEADPVVKGQTAASSYKPAVLENGIRIPVPPFIASGERVIVDTNEL
TYISRA
NT seq 561 nt   +upstreamnt  +downstreamnt
atgaagatcaatggtaatgaaatccgtcccggcaacgtcatcgaacacgaaggcgggctt
tgggttgccgtgaagaccaatgccgtcaagcccggcaagggcggcgcctataatcaggtc
gaactgaaaaacctcatcaacggcaccaagctcaacgaacgtttccgcgcagcagaaagc
gtcgaacgcgtacgccttgagcagaaggatttctcgttcctctatgaacagggcgaggcg
ctgattttcatggataccgaaacctacgaacagctcgagctccagaaggatttcgtcggc
gaccgcgccgccttccttcaggacggcatgatggtgacggttgaactttacgaagaaaag
ccaatcggcatccgcctgcccgatcaggtaacgcttgcgatcaccgaggccgatcccgtc
gtcaagggccagaccgccgcttcctcctacaagccggctgtgctcgaaaacggcattcgc
atccccgttccgccgtttatcgcctctggtgaacgggtgatcgttgacaccaacgaactg
acttatatcagccgcgcctga

DBGET integrated database retrieval system