KEGG   Brucella abortus bv. 2 86/8/59: DK55_2025Help
Entry
DK55_2025         CDS       T03321                                 

Definition
(GenBank) response regulator
  KO
K14981  two-component system, OmpR family, response regulator ChvI
Organism
babo  Brucella abortus bv. 2 86/8/59
Pathway
babo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK55_2025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:babo02022]
    DK55_2025
Two-component system [BR:babo02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   DK55_2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AIJ93778
LinkDB All DBs
Position
1:2049424..2050143
Genome map
AA seq 239 aa AA seqDB search
MKEASATQTIALVDDDRNILTSVSIALESEGYRVETYTDGASALDGLMARPPNLAIFDIK
MPRMDGMELLRRLRQKSDLPVIFLTSKDDEIDELFGLKMGADDFITKPFSQRLLVERVKA
VLRRVAARDGTAKPAGQQAKSLERGQLVMDQERHTCTWKGEPVTLTVTEFLILHSLAQRP
GVVKSRDALMDAAYDEQVYVDDRTIDSHIKRLRKKFKAVDDSFEMIETLYGVGYRFREA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagcttcggcaacgcagacgattgcgctggttgatgatgaccgcaacatcctg
acctccgtttccattgcgctggagtcggaaggttatcgcgtcgaaacctataccgacggc
gcttctgcgctggatgggttgatggcgcgtccgcccaatcttgcgatcttcgatatcaag
atgccgcgcatggacggtatggagcttctgcgccgcctgcgccagaagtccgatctgccg
gtcatcttcctcacttccaaggacgatgagatcgatgaactcttcggcctcaagatgggt
gcggacgatttcatcaccaagcctttttcgcagcgtcttctggtcgagcgtgtcaaggct
gttctgcgccgcgtggcggcgcgcgacggcacggcaaagcccgccggccagcaggccaag
tcccttgagcgcggacagctcgtcatggatcaggagcgccatacctgcacctggaagggt
gagccggttacgctgactgttaccgaatttctcatccttcactcacttgcccagcgcccc
ggcgtggtcaaaagccgtgacgccctgatggatgcggcctatgatgaacaggtctatgtg
gatgatcgcaccatcgacagccacatcaagcgtctgcgcaagaagttcaaggcggttgac
gacagcttcgagatgatcgaaacgctctacggcgtcggttatcgtttccgggaagcgtaa

DBGET integrated database retrieval system