KEGG   Brucella abortus bv. 2 86/8/59: DK55_213Help
Entry
DK55_213          CDS       T03321                                 

Definition
(GenBank) FAD binding domain protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
babo  Brucella abortus bv. 2 86/8/59
Pathway
babo00564  Glycerophospholipid metabolism
babo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:babo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DK55_213
Enzymes [BR:babo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DK55_213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIJ92346
LinkDB All DBs
Position
1:231864..233375
Genome map
AA seq 503 aa AA seqDB search
MVQEKQFDIFIIGGGINGCGIARDAVGRGFTVGLAEMNDLASGTSSRATKLIHGGLRYLE
HYEFRLVREALMEREVLWANALHIIHPMRFVLPYHKGGLRPAWLLRLGLFLYDHLGGRKK
LPATRTLNMRTDKAGEPLKPLFTKAFEYSDCWVDDARFVALTARDAADRGAKIATRTSVV
AASRGGQGWTITLEDTGTGRRENVHARLLVNAAGPWADKVLQGVEGDRQLHNIRLVQGSH
IVVRRKFSDPRAYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYKGDPAKVAITDSETDYLC
QAASEYFREPVRREDIVWTYSGVRPLYDDGASKAQEATRDYVLKEDAPDGLAPLINVFGG
KLTTARKLAEHMLQKIEHRLGRKGAPWTHAAPLPGGDFEDVAFETELKKLEAAYPFLDAR
HARRLFRLYGTRAYKLLGQASSLGDLGRHFGSDLYEAEVRYLVENEWARSAEDILWRRTK
LGLRLTAAEVAAVQGFVEPAIAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaaaacaattcgatatttttattataggtggcggcatcaatggctgcggc
attgcccgtgatgcggtggggcggggcttcaccgttgggctggccgagatgaacgatctg
gcaagcggcacctcttcgcgcgcaaccaagctcattcacggtggtttgcgctatctggaa
cattatgaattccggctggtgcgcgaggcgctgatggagcgcgaggtgctgtgggccaat
gcgctgcatatcatccatccgatgcgtttcgtgctgccttatcataagggcggcctacgt
cccgcctggctgttgcggcttggcctgtttctttacgaccatctgggcggccgcaagaag
cttcccgccacgcgcacgctcaacatgcgcaccgacaaggccggcgaaccgctgaaaccg
cttttcaccaaggcttttgaatattccgattgctgggtggacgatgcgcgcttcgtggcg
ctcaccgcccgcgatgcggctgatcgcggcgcgaagatcgcgacccgaacgagcgtcgtt
gccgcaagccgcggcgggcagggctggaccatcacactggaagataccggcaccggcagg
cgtgagaacgtacacgcccgccttctggtcaatgccgccgggccgtgggccgacaaggtt
ctgcaaggtgtggaaggcgaccggcaattgcacaatatccgtctggtgcagggcagccat
atcgtcgtgcgcaggaagttttccgacccgcgcgcctatttcttccagaacaacgacggg
cgcatcatcttcgccattccttatgaagatgatttcaccctgattggcaccacggatcag
gattataagggcgacccggccaaggtggcgatcaccgacagcgagaccgattatctctgc
caggcggcaagcgaatatttccgcgagccggtgcgccgggaggatatcgtctggacctat
tccggcgtgcgcccgctctatgatgacggggccagcaaggcgcaggaggcaacccgcgac
tatgtgctgaaggaagatgcgccagatggtctggcgccgctcatcaatgttttcggcggc
aagctcaccacagcacgcaagcttgccgaacatatgctgcagaaaatcgagcaccggctt
ggccgcaagggcgccccatggacccatgcagcaccattgccaggcggggatttcgaggat
gtggcttttgaaacggaactgaagaagcttgaggcagcctatcctttccttgatgcgcgc
catgcgcgccgcctgttccggctctatggcacccgggcatataagcttttggggcaggct
tcttcgctgggcgatcttggccgtcattttggcagcgatctctatgaggcggaagtgcgc
tatcttgtcgaaaatgaatgggcgcgaagcgcggaagacattttgtggcggcgcaccaag
ctcggcctgcgcctgacggcggcggaagtcgcggccgtgcagggctttgtggagcctgca
atcgccgcctaa

DBGET integrated database retrieval system