KEGG   Brucella abortus bv. 6 870: DO74_1294Help
Entry
DO74_1294         CDS       T03392                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Mn
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
babr  Brucella abortus bv. 6 870
Brite
Enzymes [BR:babr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DO74_1294 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIJ64376
LinkDB All DBs
Position
1:complement(1311094..1311693)
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDYDALAPFMSRETLEYHHDKHHQAYVTNGNKLLEGSGLEGKSFEEIVKES
FGKNQALFNNAGQHYNHIHFWKWMKKDGGGKKLPGKLEKAFDSDLGGYDKFRADFIAAGA
GQFGSGWAWLSVKDGKLEISKTPNGENPLVHGAAPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLVNWDYVLEMYEKAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaactgcccgcccttccgtatgactatgatgcgcttgcgcctttcatgtcg
cgcgaaacgcttgaatatcatcacgacaagcatcatcaggcctatgttaccaacggtaac
aagcttctcgaaggttccggcctggaaggcaagagcttcgaagaaatcgtcaaggaaagc
ttcggcaagaatcaggccctcttcaacaatgccggccagcactacaaccatatccatttc
tggaaatggatgaagaaggatggcggcggcaagaaactgccgggcaagctggaaaaggcc
tttgattccgatcttggcggttatgacaagttccgcgctgatttcatcgctgccggtgcc
ggccagttcggttcgggctgggcctggctttccgtcaaggacggcaagcttgaaatttcc
aagaccccgaacggtgaaaacccgctcgtgcacggtgcggcgccgatcctcggcgtggat
gtgtgggaacactcctattacatcgattaccgcaacgcgcgtccgaaatatctcgaagct
ttcgtcgatagcctcgtgaactgggattacgtgctggaaatgtacgaaaaggcggcataa

DBGET integrated database retrieval system