KEGG   Brucella abortus bv. 6 870: DO74_230Help
Entry
DO74_230          CDS       T03392                                 

Gene name
ygbF
Definition
(GenBank) tol-pal system protein YbgF
Organism
babr  Brucella abortus bv. 6 870
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_6 TPR_16 YfiO TPR_2 ANAPC3 TPR_14 TPR_4 TPR_12 TPR_19 LUC7 TPR_18
Motif
Other DBs
NCBI-ProteinID: AIJ63356
LinkDB All DBs
Position
1:236622..238076
Genome map
AA seq 484 aa AA seqDB search
MRKVTLAMAMLPLLASAPVLAASVSSQEKAIYLAQAGDPGMSQFAQQVCTIARQNAQSYS
RILQLRDKMLKIQRDNEARFQALEKGRGGAQNHVSIGSTAILDDAMRGNGGVFGQGGGYQ
SPGMQQELVRNLTGKVEDVDAQISFTDNQLQKTQEDNEFRFEELEKKKGLTPPQAQRTSQ
PAQPAPAPGADLCAQGMGNPVAIADALSARAEAMNFQILEMQDQMQKMQEENERRFQALE
SGGRADAGGSSRDTSLADAGAAGSLDGGVSGSAGSQAMASSSSQQSAADSVAIGSAASQG
GPARGEPPQTLGSIRFDTNGNVIGETLNAAPQPVQQGGGGIQTGGAANDAVASLPTDDNP
NSLYQAAYQYLMSGDYKAAEAGFREHVKRYPADPMTAEARFWLGESLYGQGRYPEAATLF
IDTQRDYPDSKRAPENMFKLGMALEKMDNHDVACATFAQIPQRYPKAAPAILKRVADERS
RAKC
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtgacactggccatggccatgctgccgcttttggcaagtgctccggtgctg
gcggcatctgtttcttcgcaggaaaaagccatctatctcgcgcaggctggcgatccgggc
atgagccagttcgcccagcaagtgtgcactattgcgcgtcagaatgcacagtcctattcc
cggattttgcagcttcgcgacaagatgctgaaaatccagcgggacaatgaagcccgtttt
caggcgctggaaaagggacgcggaggcgcacagaatcatgtcagcatcggctcgaccgca
atccttgacgatgccatgcgcggtaatggcggcgtctttggccagggtggcggctatcag
agtcccggcatgcagcaggaactggtccgcaacctgaccggcaaggtcgaggatgtggat
gcgcagatttccttcaccgacaaccagttgcaaaaaacccaggaagacaatgaattccgg
tttgaggaactggaaaagaaaaagggcctgacgccgccgcaggcgcagcgcacaagccag
cctgctcagcctgcgcccgcaccgggcgctgacctttgtgcgcagggcatgggcaatccc
gtcgcgattgcagacgcattgagcgcgcgcgcggaagccatgaatttccagattctggaa
atgcaggatcagatgcagaagatgcaggaggaaaacgaacgccgttttcaggcgctggaa
tcgggtggccgcgcggatgcgggcggttcttcccgcgatacgtctcttgccgatgcgggt
gcagccggaagccttgatggcggggtttccggttctgccggttcgcaggctatggcctct
tcgtcttctcagcaatctgccgccgattccgtggctattggttccgccgcctcgcagggc
ggcccggcaagaggcgagccgccgcaaacgctcggctcgatccgcttcgacaccaatggc
aatgtaatcggcgaaacgctcaacgccgcgccgcagcccgtgcagcaagggggagggggg
attcagaccggcggtgccgccaatgatgcggttgcctcgcttcccaccgacgacaatccc
aactcgctttatcaggctgcgtatcaatatctcatgtctggtgattacaaggctgccgaa
gcgggctttcgcgagcatgtaaagcgctatcctgccgacccgatgacggcggaggcgcgc
ttctggcttggcgaatcgctctatggtcagggccgttaccccgaagctgcaactcttttc
atcgatacgcagcgcgattatcccgattccaagcgcgcgccggaaaacatgttcaagctt
ggcatggcgctggagaaaatggacaatcatgatgtcgcctgcgcgaccttcgcgcagatt
ccccaacgctatcccaaggcggcgccagccattttgaagcgtgtcgccgatgagcgcagt
cgcgccaagtgctga

DBGET integrated database retrieval system