KEGG   Brucella abortus bv. 6 870: DO74_349Help
Entry
DO74_349          CDS       T03392                                 

Definition
(GenBank) anthranilate synthase
  KO
K13503  anthranilate synthase [EC:4.1.3.27]
Organism
babr  Brucella abortus bv. 6 870
Pathway
babr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
babr01100  Metabolic pathways
babr01110  Biosynthesis of secondary metabolites
babr01130  Biosynthesis of antibiotics
babr01230  Biosynthesis of amino acids
Module
babr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:babr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DO74_349
Enzymes [BR:babr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     DO74_349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind GATase Peptidase_C26 Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AIJ64959
LinkDB All DBs
Position
1:353924..356119
Genome map
AA seq 731 aa AA seqDB search
MNAKTADSEIFQHETAGGIIVERVRHLTAYKGAIESYIDVLNEWRGAVFSSNYEYPGRYT
RWDTAIVDPPVVITSRARTMRIEALNARGVILLRPILDTVKALSEVKIDQSGENRIDLTI
VEPVGTFTEEERSRMPSVFTVLRAIVGLFFSEEDANLGLYGAFGYDLAFQFDPIQYKLKR
PDDQRDLVLFIPDEIFVADHYAARAWVDRYEFRCGGSSTHGLDRATPVVPFKPSERKLAR
GDHNPGEYARLVERAKESFKRGDLFEVVPGQTFYERCHTAPSEIFRRLKSINPSPYSFFI
NLGESEYLVGASPEMFVRVNGRRIETCPISGTIKRGEDAISDSEQILKLLNSKKDESELT
MCSDVDRNDKSRVCEPGSVRVIGRRQIEMYSRLIHTVDHIEGRLRDGMDAFDGFLSHAWA
VTVTGAPKLWAMRFLEENERSPRAWYGGAIGMMHFNGDMNTGLTLRTIRIKDGVAEIRAG
ATLLFDSNPDEEEAETELKASAMIAAVRDAQKSNQIAEESVAAKVGEGVSILLVDHEDSF
VHTLANYFRQTGAKVSTVRSPVAEEIFDRVNPDLVVLSPGPGSPQDFDCKATIDKARKRQ
LPIFGVCLGLQALAEAYGGALRQLRVPVHGKPSRIRVSKPERIFSGLPEEVTVGRYHSIF
ADPERLPDDFLVTAETEDGIIMAFEHKHEPVAAVQFHPESIMTLGHNAGMRMIENVVTHL
AGKHKARRTNY
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgaagactgcggatagcgagatattccagcacgaaacggctggcggtatcatc
gtcgagcgggtgcgccacctcacggcctataagggcgccattgaaagctatatcgatgtg
ctgaacgaatggcgcggtgcggtgttctcgtccaattacgaatatccgggccgctatacg
cgatgggataccgcaattgtcgatccgccggtcgtcatcacgtcgcgtgcccgcacgatg
cgcatcgaggcgctgaacgcgcgcggcgtcatcctgcttcggcccattctggataccgtc
aaggcgctttcggaagtaaagatcgaccagtccggcgaaaaccgtatcgatctgacgatt
gtggaaccggtcggcaccttcacggaagaagaacgctcgcgcatgccctcggtctttacg
gtgctgcgcgccatagtcgggcttttcttctcggaggaggatgccaatctcggcctttat
ggcgcctttggctatgatctggcgttccagttcgatcccatccagtacaagctgaagcgc
ccggacgaccagcgtgacctcgtgctgttcattcccgacgaaatcttcgtcgccgaccat
tatgcggcgcgcgcctgggtggaccgttatgaatttcgctgcggcggttcgtccacgcac
ggtcttgatcgcgcgacgccggtggtgcctttcaagccatcggagcgcaagcttgcgcgc
ggcgatcataatccgggtgaatatgccaggcttgtcgagcgcgccaaggaaagcttcaag
cgcggcgacctgttcgaggttgtgccgggccagaccttctatgagcgctgccacacggcg
ccgtcggagattttccgccggctgaagtcgatcaatccttcgccctattcctttttcatc
aatctgggcgagagcgaatatctggtcggcgcatcgccggaaatgtttgtgcgcgtcaat
gggcggcgcatcgagacctgcccgatttccggcaccatcaagcgcggtgaagatgcaatt
tcggattctgagcagatattgaaactgcttaattccaagaaggacgaatccgagctgacc
atgtgttcggatgtggaccgcaacgacaagagccgcgtttgcgagccgggttcggtgcgt
gttatcggtcgccgccagatcgagatgtattcccgcctgatccatacggtcgatcatatc
gaaggccgcctgcgtgacggcatggatgcgtttgacggcttcctcagccatgcatgggct
gtgacggtgacaggcgcgccgaagctgtgggcaatgcgctttcttgaggaaaacgaacgc
agcccgcgcgcatggtatggcggcgcgatcggcatgatgcatttcaatggcgatatgaat
acagggctgacgctgcgcaccatccgcatcaaggatggtgtggcggaaatccgtgcaggg
gcgacgcttctgttcgattccaaccctgacgaggaagaagccgagaccgaattgaaggca
tcggccatgattgcggctgtgcgggacgcacagaagagcaatcagatcgcggaagaaagt
gtggcggcaaaggtgggtgagggggtttcgatcctgctggtcgatcacgaggattccttc
gtccatacgcttgccaattatttccgccagacgggcgccaaggtttccaccgtgcgttca
ccggtggcagaggagatattcgaccgcgtcaatcccgatctggtggtgttatcgccggga
ccgggctcgccgcaggatttcgattgcaaggcgaccatcgataaggcgcgcaagcgccag
cttccgatttttggcgtctgcctcggccttcaggcactggcggaagcctatggcggggcg
ttgcgccagcttcgcgttccggtgcatggcaagccttcacgcatccgcgtatcaaagccg
gagcgcattttctccggcttgccggaggaagtgacggtggggcgttatcattcgatcttc
gccgatcctgaacgcctgccggatgattttctcgtcacagccgaaacggaagacgggatc
atcatggcttttgaacataaacatgaaccggtggcagccgttcaattccatcccgaatcc
atcatgacgcttggccataatgccggtatgcgcatgatcgagaatgtcgtgacgcatctt
gcaggcaagcacaaggcgcgccgcaccaactattga

DBGET integrated database retrieval system