KEGG   Brucella abortus bv. 6 870: DO74_44Help
Entry
DO74_44           CDS       T03392                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur family protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
babr  Brucella abortus bv. 6 870
Pathway
babr00020  Citrate cycle (TCA cycle)
babr00190  Oxidative phosphorylation
babr00650  Butanoate metabolism
babr01100  Metabolic pathways
babr01110  Biosynthesis of secondary metabolites
babr01120  Microbial metabolism in diverse environments
babr01130  Biosynthesis of antibiotics
babr01200  Carbon metabolism
Module
babr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
babr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
babr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:babr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DO74_44
   00650 Butanoate metabolism
    DO74_44
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DO74_44
Enzymes [BR:babr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DO74_44
    1.3.5.4  fumarate reductase (quinol)
     DO74_44
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AIJ63366
LinkDB All DBs
Position
1:39852..40631
Genome map
AA seq 259 aa AA seqDB search
MVELALPKNSRMQEGKTWPRPDGATRVTEFRIYRWSPDDDENPRIDTYYVDRDDCGPMVL
DGLLYIKNKIDPTLTLRRSCREGICGSCAMNIDGANTLACTKGMDDIKGTIKVYPLPHMP
VVKDLVPDLNNFYAQHRSIEPWLKTVSPEPQKEWLQSHEDRQKLDGLYECILCACCSTSC
PSYWWNGDRYLGPAVLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactcgcacttcccaagaattcccgtatgcaggagggcaagacctggccccgt
cctgatggcgccacccgtgtcacggaattccgcatctatcgctggtcgccggatgacgac
gaaaatccgcgtatcgatacctattatgtcgatcgtgacgattgtggtccgatggttctg
gacggtctgctctatatcaagaacaagatcgacccgacgctgacgctgcgccgttcgtgc
cgtgaaggcatttgcggttcctgcgccatgaatatcgatggcgcgaacacgcttgcctgc
accaagggtatggacgacatcaagggcaccatcaaggtctatccgctgccgcatatgccg
gtggtgaaggatcttgtgccggacctcaataatttctacgcccagcaccgttccattgag
ccatggctcaagacggtttcgccggagccgcagaaggaatggctgcaaagccatgaggac
cgccagaagctcgatggtctttatgagtgcattctgtgcgcctgctgctcgacctcatgc
ccgagctattggtggaacggcgaccgttatcttggccccgccgtgctgcttcaggcctat
cgctggctgatcgattccagagacgaagccaagggcgaacgcctcgataaccttgaggat
ccgttccggctttatcgctgccatacgatcatgaattgcgcccagacctgcccgaagggt
ctgaacccggccaaggcgattgccgaaatcaagaagatgatggtcgagcgccgcgtgtaa

DBGET integrated database retrieval system