KEGG   Brucella abortus bv. 6 870: DO74_808Help
Entry
DO74_808          CDS       T03392                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase family protein
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
babr  Brucella abortus bv. 6 870
Pathway
babr00340  Histidine metabolism
babr01100  Metabolic pathways
babr01110  Biosynthesis of secondary metabolites
babr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:babr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DO74_808
Enzymes [BR:babr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     DO74_808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: AIJ63031
LinkDB All DBs
Position
1:complement(829661..830080)
Genome map
AA seq 139 aa AA seqDB search
MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETG
IAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYR
QIVSSGGKVALTMASDHDQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttcctgcccagccttccgacaagaaggccgttgaagaaggcgcggcattc
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
cagatcgtttcgtcgggtggcaaggtggcgctgacaatggcaagcgatcacgatcaataa

DBGET integrated database retrieval system