KEGG   Brucella abortus 63 75: DK49_1783Help
Entry
DK49_1783         CDS       T03461                                 

Definition
(GenBank) HAMP domain protein
  KO
K14980  two-component system, OmpR family, sensor histidine kinase ChvG [EC:2.7.13.3]
Organism
babt  Brucella abortus 63 75
Pathway
babt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:babt00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DK49_1783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:babt01001]
    DK49_1783
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:babt02022]
    DK49_1783
Enzymes [BR:babt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DK49_1783
Protein kinases [BR:babt01001]
 Histidine kinases
  OmpR family
   DK49_1783
Two-component system [BR:babt02022]
 OmpR family
  ChvG-ChvI (acidity sensing)
   DK49_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Stimulus_sens_1 Sensor_TM1 HATPase_c HisKA HAMP HATPase_c_3 DUF3454 HATPase_c_2 Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: AIJ80797
LinkDB All DBs
Position
1:1796394..1798199
Genome map
AA seq 601 aa AA seqDB search
MVAETQKDSLSGMRERRARRQRSVFLRRFLSPLRKFLGQYLFSSLTRRILFLNLAALAVL
VSGILYMNQFREGLIDAKIESLLTQGKIIAAAISASVTVDTNSLLIDPEKLLELQAGQSI
TPSPDSPDNWEFPINPEKVSPLLRQLISPTSTRARIYDRYANKLLDSRALYSTSFPSSGP
VLRYDLPPIEDETPALWERIGSWLSRLFYGGGLPLYQEQPGGNGLAYQEIVKALSGSPQM
AQRRNQRGELIVSVAVPIQRSRAILGVLLLSTEGDDIDKIVQAERMAVFRVFGVVSAVMV
ILSLFLASTIANPLRKLSAAADRVRHGVKNRVEIPDFSERQDEVGHLSTSIRDMTDALYT
RIEAIESFAADVSHELKNPLTSLRSAVETLPLAKTDESRKRLLDVIQHDVRRLDRLITDI
SDASRLDAELAREHIDRVDMKKLLTSLVTAAREVRRNKVGTEIVFNTGKLPTGKKGFYVA
GHDLRLGQVVSNLIENARSFVPDDTGRIVVTLAGEGNRLRILVEDNGPGIPIENIERIFE
RFYTDRPASEAFGQNSGLGLSISRQIIEAHGGALTAENITDPDKPDIFKGARFIVDLPAS
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcagagacccagaaagatagcctttcggggatgcgcgagcgcagagcacggcgg
caacgctcggtgtttctgcgccgctttctgtcgcccttgcgcaagtttcttgggcaatat
ctcttttcaagcctgacgcgccgcatcctgtttctcaacctggcagcactggccgttctg
gtttccggcattctttatatgaaccagttccgcgaggggctgatcgacgccaagatcgaa
agcctgctgacgcagggcaagatcatcgctgctgcgatttctgcatcggttacggtcgat
accaattcgctgctgatcgaccctgaaaagcttctggagcttcaggccgggcagagcata
accccctcccccgattcgccggataattgggaatttccgatcaatcccgaaaaggtttcg
ccgctgctgcgccagttgatctctccgaccagcacgcgcgcgcgcatctatgaccgctat
gcgaataagctgcttgattcgcgcgcgctttattcgacaagcttcccgtccagcgggccg
gtcctgcgctatgacctgccgccgatagaggatgagacgcctgccctttgggaacgtatc
ggcagctggctgtcgcgccttttctatggcggtggcctgccgctctaccaggagcagccg
ggcggaaacggccttgcctatcaggaaatcgtcaaggcgctgagcggctcgccgcagatg
gcacagcgccgcaatcagcgcggtgagctgatcgtttccgtggccgttcctatccagcgc
tcccgtgccattctgggtgttctgcttctttctaccgaaggcgatgatatcgacaagatc
gttcaggccgagcgtatggcggttttccgcgtgttcggcgttgtgtcggcggtcatggtc
atcctgtcgcttttcctcgcctcaacaattgccaaccccttgcgcaagctttcggctgcg
gcggaccgggtgcgccatggcgtgaaaaaccgcgtggaaattcccgatttttccgagcgt
caggacgaggtgggccacctttccacctccatccgcgacatgacggacgcgctttatacg
cgcatcgaagccattgaaagcttcgcagccgatgtcagccatgagctgaagaaccccctc
acctcgcttcgcagcgcagtcgaaaccctgccgctcgccaagaccgacgaatcacgcaag
cgcctgctcgatgtcatccagcacgacgtgcggcggctggaccgccttatcacggatatt
tccgacgcttcgcgcctcgatgccgagcttgcgcgcgaacatatcgaccgcgtggatatg
aaaaagcttctcaccagccttgtgactgccgcccgcgaagtgcggcgcaacaaggtcggc
accgaaatcgtgttcaacacgggcaagctgcccaccggcaagaaaggcttctatgtcgcc
ggccacgatctgcgtcttgggcaggtggtaagcaaccttatcgagaatgcgcgctccttc
gtgcctgacgatacgggccgtatcgtcgttacgctggccggcgaaggcaaccggctgcgc
attctggtcgaggataacggccccggcattcctatcgagaatatcgagcgcatcttcgag
cgtttctacacggatcgcccggcatcggaagcattcgggcagaattccggcctcggcctg
tcgatcagccggcagatcatcgaggcgcatggcggcgcgctgacggcggaaaatattacc
gatccggataagccggatattttcaagggtgcccgctttatcgttgatcttccggccagc
gcatga

DBGET integrated database retrieval system