KEGG   Brucella abortus 63 75: DK49_834Help
Entry
DK49_834          CDS       T03461                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
babt  Brucella abortus 63 75
Brite
KEGG Orthology (KO) [BR:babt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DK49_834
Enzymes [BR:babt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DK49_834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 SPOR Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AIJ80276
LinkDB All DBs
Position
1:complement(826274..827467)
Genome map
AA seq 397 aa AA seqDB search
MLKSSSRISRFFASVAFGTAVLCASGAMASTSWVVFDADSGRMLGQDDASAQHAPASLAK
MMTLYLTFEALKTGRLHWDDALPISKNAASKVRMKLWLKAGDTISTRDAVNGMIIVSAND
AATVMGEYLAGSEAAFARLMTQRARQIGMKSTIFANPSGLTANVSQLTTARDMAVLGMAL
RRDFPEEYALFSQRSFTFRGRVYNGHNNLMYRYAGVDGIKTGYTNVSGYNLVSSAYINNR
HLVGVVLGAGSAGQRDGQMAKLLTRFGGVDNGKAAPLVAMAKPQAVTAKLKPDVVADLID
DTQIEQGDGGYPVTSGRSNWRIQLAATPSRAGASELQEKYAPVVSRIVPGAKGEISPSPK
GRKVYRVRFSGVRDSAAASKACAQLKRQQIACLAIQN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaatcgtcgtcccgtatttcgcgtttctttgcgtccgtcgcatttggaacagcc
gttctttgtgcgtcaggcgcaatggcgagcacatcatgggttgtgttcgatgcggatagc
gggcggatgctggggcaggacgatgcaagcgcgcagcacgcgccagcctcacttgccaag
atgatgacgctctatctcaccttcgaggccttgaagactggccggttgcattgggacgat
gcgctgccgatttcaaaaaatgcggcttccaaggttcggatgaagctgtggctgaaggcc
ggcgacacgatttctacccgcgatgcagtcaacgggatgattatcgtctcggcaaatgat
gctgcgactgtcatgggcgaatatcttgccggctcggaggccgcttttgcgcgcctgatg
acacagcgcgcgcgccagatcggcatgaaaagcaccattttcgccaatccttcggggctg
accgcgaatgtcagccagttgacgactgcacgcgacatggcggtgctgggcatggctctt
cggcgagatttcccggaagaatatgcgttgttttcgcagcgctccttcacttttcgcggg
cgcgtctataacgggcacaacaacctgatgtaccgctatgcgggtgtggatggcatcaag
accggctatacaaatgtatccggctataatctggtgtcgtcggcttatatcaacaacagg
catctggtgggcgtggttctgggcgcaggctctgccgggcagcgcgatggccagatggcg
aaacttctgacgcgctttggcggtgtcgataatggcaaggccgcgcctctggttgccatg
gcgaagccgcaggcggttactgcgaaactgaagccggatgtggttgccgatctgatcgac
gatacccagatcgagcagggggatggcggctatccagtgacttccggcagatcgaactgg
cgcattcagctggcggcaacgccaagccgtgcgggtgccagcgaattgcaggagaaatat
gcacccgtggtttccaggatcgtgcccggcgcaaagggcgaaatctcgccttcgcccaag
ggtcgcaaagtctatcgcgtgcgtttttccggcgtcagggattcggctgccgcaagcaag
gcctgcgcgcagctcaagcgccagcaaatcgcctgcctggctattcagaactag

DBGET integrated database retrieval system