KEGG   Brucella abortus bv. 9 C68: DK53_1064Help
Entry
DK53_1064         CDS       T03474                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase family protein
  KO
K01496  phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00340  Histidine metabolism
babu01100  Metabolic pathways
babu01110  Biosynthesis of secondary metabolites
babu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:babu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DK53_1064
Enzymes [BR:babu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     DK53_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH
Motif
Other DBs
NCBI-ProteinID: AIJ60189
LinkDB All DBs
Position
1:1077060..1077479
Genome map
AA seq 139 aa AA seqDB search
MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETG
IAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYR
QVVSSGGKVALTMASDHDQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttcctgcccagccttccgacaagaaggccgttgaagaaggcgcggcattc
atgccgcgctttgatgcatccggcctcattacagcgatcgtcactgatgcgcgcgatggc
gaattgctgatggtcgcgcatatgaacgaggaagccctgcgccttacactggaaaccggc
attgcccattattggtcgcgctcgcgcaagacgctatggaaaaagggcgaaacctccggc
aacctgcaaagcgtggtcgaattgcgcacggattgcgatcaggatgcactctggctgaaa
gtgcacgtcgccggtgacggcccgacatgccatacggggcgtcgttcgtgcttctatcgt
caggtcgtttcgtcgggtggcaaggtggcgctgacaatggcaagcgatcacgatcaataa

DBGET integrated database retrieval system