KEGG   Brucella abortus bv. 9 C68: DK53_212Help
Entry
DK53_212          CDS       T03474                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00010  Glycolysis / Gluconeogenesis
babu00071  Fatty acid degradation
babu00350  Tyrosine metabolism
babu00625  Chloroalkane and chloroalkene degradation
babu00626  Naphthalene degradation
babu01100  Metabolic pathways
babu01110  Biosynthesis of secondary metabolites
babu01120  Microbial metabolism in diverse environments
babu01130  Biosynthesis of antibiotics
babu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:babu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DK53_212
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DK53_212
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DK53_212
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DK53_212
   00626 Naphthalene degradation
    DK53_212
Enzymes [BR:babu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DK53_212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AIJ60767
LinkDB All DBs
Position
1:229479..230513
Genome map
AA seq 344 aa AA seqDB search
MAKTMKAAVVRAFGKPLTIDEVPIPQPGPGQIQVAIQASGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGFVSAVGSGVKHVKEGDRVGIPWLYTACGHCRHCLGGWETLCEEQLNTGYSV
NGGFAEYVVADPNFVGHLPKNIDFNEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHMAVQYARAMGLNVAAVDIDDRKLDLARRLGATVTVNAKTVADPAAYIRKETDGGAQGV
LVTAVSPKAFEQALGMVARGGTVSLNGLPPGDFPLSIFNMVLNGVTVRGSIVGTRLDLQE
SLDFAADGKVKATIQTGKLEDINAIFDDMRQGNIEGRIVMDLTQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgatgaaagctgcggtcgtgcgtgccttcggcaaaccgctgacgattgat
gaagtgccgatacctcaacccggtcccggccagattcaggttgccattcaggcttccggc
gtatgccataccgaccttcatgccgccgagggcgattggccggtaaaacccaatccgccc
ttcattccgggtcatgagggtgtcggtttcgtttccgccgtgggcagcggcgtcaagcat
gtcaaggaaggcgaccgtgtcggcattccatggctttacactgcctgcggccattgccgc
cattgccttggtggctgggaaacgctttgcgaggaacagctcaataccggctattccgtc
aatggcggctttgccgaatatgtggtggccgatccgaatttcgtcggccacttgccgaag
aatatcgatttcaacgagattgcgccggtgctctgcgcgggcgtgacggtctataagggc
ctcaaggtcacggatacgaagcccggtgactgggtggtcatttcaggcataggcgggctc
ggccacatggctgtgcaatatgccagggccatggggctgaatgttgccgccgtcgatatt
gacgaccgcaagctcgatctcgcccgcagacttggcgcaaccgttacggtcaacgctaag
acggttgccgacccggcagcctatattcgcaaggaaaccgatggcggtgcgcaaggcgtg
ctggtgacggcggtttcgcccaaggcttttgaacaggcgctgggcatggttgcgcgcggc
ggtactgtttcgctgaatggcctgccgcctggcgatttcccgctttccatcttcaacatg
gtgctcaatggcgtaacggtgcgcggctccatcgtggggacgcggcttgatttgcaggaa
tcgctcgattttgcagccgacggcaaggtcaaggccaccatccaaaccggcaagctggaa
gacatcaacgccatcttcgacgatatgcggcaaggcaatatcgaaggccgcatcgtgatg
gacctgactcaatag

DBGET integrated database retrieval system