KEGG   Brucella abortus bv. 9 C68: DK53_2315Help
Entry
DK53_2315         CDS       T03474                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00473  D-Alanine metabolism
babu01100  Metabolic pathways
babu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:babu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DK53_2315 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    DK53_2315 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:babu01011]
    DK53_2315 (alr)
Enzymes [BR:babu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DK53_2315 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:babu01011]
 Precursor biosynthesis
  Racemase
   DK53_2315 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF294_C
Motif
Other DBs
NCBI-ProteinID: AIJ61963
LinkDB All DBs
Position
2:complement(248647..249846)
Genome map
AA seq 399 aa AA seqDB search
MVEMSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRV
APAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLE
QVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLAN
GDEPGNAVNARQLAKMMALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPER
QHDFSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAV
GYADGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQR
LEDVARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcata
ttgaccattgatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgcc
ccaacccgtacggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtc
gcaccggctttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagca
gtggcgctgaagccctttttgaaacccgacgcaacactttatgtcctgaacggccttcag
cccggaacggaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaa
caggttgaaaactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctc
cagttcgataccggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttctt
gagaacgtcacgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaac
ggcgacgagccgggaaatgcggtaaatgcccgtcagcttgccaagatgatggccttgctc
gctcgcctgccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaag
acctattatttcgatctcgcccgccccggcatcgcgctatatggcatcgatccggagagg
cagcatgacttttcggataaggtggcgcacgagaataagaaacccaagcattcgatcctt
cccgtcctcaccctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgaca
gttggctatggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtc
ggctatgctgacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgat
acgcgcctgcccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctca
ttgccggagggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagcgc
ctcgaagacgtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggc
aaccgttatgcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system