KEGG   Brucella abortus bv. 9 C68: DK53_2818Help
Entry
DK53_2818         CDS       T03474                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00220  Arginine biosynthesis
babu00250  Alanine, aspartate and glutamate metabolism
babu00471  D-Glutamine and D-glutamate metabolism
babu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:babu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DK53_2818 (glsA)
   00220 Arginine biosynthesis
    DK53_2818 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DK53_2818 (glsA)
Enzymes [BR:babu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     DK53_2818 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AIJ61957
LinkDB All DBs
Position
2:complement(783950..784903)
Genome map
AA seq 317 aa AA seqDB search
MSSSSDAIKAALEKGRAAGLSATGGKNADYIPFLASVPSDLFGLAVVTADGQTFKTGDAD
IAFAIESISKVFTLALVMEEIGPDSVREKVGADPTGLPFNSVIALELHNGKSLSPLVNAG
AIATASLVPGDTADALWNNILECQCGFAGRRLKLSNEVNQSEQTTNFHNRAIAWLLYSAG
TCYSDPMEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPISGKRMVSAGNVAPILAEMT
MEGLYTALGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFSPPLDPAGNSVKAMAAVAAV
ADSLGHNLYTTRGKVSS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcatcagatgcgatcaaagccgctcttgagaagggacgcgcagcaggcctt
tctgcaaccggcggcaagaatgccgactatattccattcctggcgtcggttccgtccgac
ctgttcggtctggccgtggtgacggcggacggccagacttttaaaaccggcgatgccgat
atcgccttcgctatcgagtcgatttccaaggttttcacccttgccctggttatggaggag
attggtcccgatagtgtgcgggaaaaggtcggtgctgacccgaccgggctgccgttcaat
tctgtaatcgcgctcgaactccataacggcaagtcgctttcgccgctggtcaatgcaggc
gcaattgcaactgcaagccttgttcccggcgatacggcggatgccctctggaacaatatt
ctggaatgccagtgcggttttgcgggccgccggctcaagcttagcaacgaggtcaaccag
tccgaacagacgaccaattttcacaaccgcgccattgcctggctgctttacagtgccggt
acttgctacagcgatccgatggaggccgtggatatttatacgcgccaatgttcaacgctt
gtaaccgcgaccgaccttgccacgatgggggcaacccttgccgccggcggtgttaatccg
atcagcgggaagcgcatggtttcggcaggcaatgttgccccaattctggccgaaatgacc
atggaaggcctttatacggctttaggcgattgggcttatacggtcggcctacccggtaaa
agcggtgtcggtggtggcatcatggcggtagtgccgggtgagctggcaattgccgcgttt
tcaccgccgcttgatccagccggaaatagtgtgaaagcaatggctgctgttgccgcagtg
gcagattcacttggccataatctttataccaccagagggaaagtgtcatcctga

DBGET integrated database retrieval system