KEGG   Brucella abortus bv. 9 C68: DK53_5Help
Entry
DK53_5            CDS       T03474                                 

Gene name
fabA
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
babu  Brucella abortus bv. 9 C68
Pathway
babu00061  Fatty acid biosynthesis
babu01100  Metabolic pathways
babu01212  Fatty acid metabolism
Module
babu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:babu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DK53_5 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:babu01004]
    DK53_5 (fabA)
Enzymes [BR:babu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DK53_5 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     DK53_5 (fabA)
Lipid biosynthesis proteins [BR:babu01004]
 Fatty acid synthase
  Component type
   DK53_5 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AIJ60244
LinkDB All DBs
Position
1:complement(3022..3540)
Genome map
AA seq 172 aa AA seqDB search
MAEQKSSYGYEELLACGRGEMFGPGNAQLPLPPMLMIHRITEISETGGAFDKGYIRAEYD
VRPDDWYFPCHFQGNPIMPGCLGLDGMWQLTGFFLGWLGEPGRGMALSTGEVKFKGMVRP
HTKLLEYGIDFKRVMRGRLVLGTADGWLKADGELIYQATDLRVGLSKEGSAQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacagaaatcgagctacgggtatgaagaactcctggcctgcggccgcggcgag
atgttcggacccggcaacgcgcagcttcctctgcctccgatgctgatgatccaccgcatc
accgagatctctgaaacgggcggtgccttcgacaagggctatatccgcgcggaatatgat
gtgcgtcccgatgactggtatttcccttgccactttcagggcaacccgatcatgccgggc
tgtctcggcctcgacggcatgtggcagctcacgggcttcttcctcggctggctgggcgag
ccgggccgcggcatggccctttccaccggcgaggtaaagttcaagggcatggttcgcccg
cacaccaagcttctggaatatggcatcgacttcaagcgcgtgatgcgcggtcgcctcgtg
ctcggcacggctgacggctggctgaaggccgatggcgagctcatctatcaggcaaccgat
ctgcgggtcggcctgtccaaggaaggcagcgcgcaataa

DBGET integrated database retrieval system