KEGG   Burkholderia ambifaria MC40-6: BamMC406_0261Help
Entry
BamMC406_0261     CDS       T00684                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:bac00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    BamMC406_0261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bac03012]
    BamMC406_0261
   03029 Mitochondrial biogenesis [BR:bac03029]
    BamMC406_0261
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bac04147]
    BamMC406_0261
Translation factors [BR:bac03012]
 Eukaryotic Type
  Elongation factors
   BamMC406_0261
 Prokaryotic Type
   BamMC406_0261
Mitochondrial biogenesis [BR:bac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BamMC406_0261
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BamMC406_0261
  Exosomal proteins of breast cancer cells
   BamMC406_0261
  Exosomal proteins of colorectal cancer cells
   BamMC406_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_29 AAA_23 Lsm_C
Motif
Other DBs
NCBI-ProteinID: ACB62762
UniProt: B1YRB5
LinkDB All DBs
Position
1:306816..308006
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMSLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagtttgagcggaccaagccgcacgtcaacgttggaacgatcggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgacggtgctgacgaagaagttc
ggcggcgaagcgaaggcctacgaccagatcgacgcggcaccggaagaaaaggcgcgcggc
atcacgatcaacacggcacacgtcgagtacgaaacggctaaccgccactacgcacacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcagcgcagatggac
ggcgcgatcctggtttgctcggcagcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgaactcctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggcgaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgagcctggcagacgcactggacacg
tacatcccgacgccggagcgtgcagttgacggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggtacggtggtgacgggtcgtgtcgagcgcggcatcgtgaag
gtcggcgaagaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccaaggtcaggcaggcgacaacgtcggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgtggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggctgaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgctccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggtggccgtaccgtcggcgccggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system