KEGG   Burkholderia ambifaria MC40-6: BamMC406_0337Help
Entry
BamMC406_0337     CDS       T00684                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00730  Thiamine metabolism
bac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BamMC406_0337
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     BamMC406_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACB62838
UniProt: B1YRU0
LinkDB All DBs
Position
1:383467..384603
Genome map
AA seq 378 aa AA seqDB search
MNVHASRPDFAVLGGGLVGRLIAWRLAGDGHRVALYERGGPDGEQSAAWIAAAMLAPLAE
AASAELLITELGVASLARWPQWLAELPEPVFFQHHGTLVVWHHADRAEAPLFERRVRANA
PAELFDGGFVTLAGAQVDAAEPALAGRFARGLLLPREGQLDNRQALRALAAGLAQRGVEL
HWHATIDDANHPDAHFTIDCRGLGAKAALPALRGIRGEVARVRAPGIGLTRPVRLLHPRY
PLYIAPKQDDLYVIGATEVEGEDMSPVSVRSALELLSAAFSVHPAFGEARILELNAQCRP
TLPDHRPAVIWDGATTLAVNGLYRHGFMIAPEVAHAAVAFAQAALGGAFADADAFTAWRD
AARWPALLHHRDDARQPA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtccacgcttcacgaccggatttcgcggtgctcggcggcggcctcgtcggccgt
ctgatcgcctggcggctcgcgggcgacgggcatcgcgtcgcgctgtacgagcgcggcggc
ccggacggcgagcagtcggccgcatggatcgcggccgcgatgctcgcgccgctcgccgag
gcggcgagcgccgagctgctgatcaccgagcttggcgtcgcgtcgctcgcgcgctggccg
cagtggctcgcggagctgcccgaaccggtgttcttccagcatcacggcacgctcgtcgtc
tggcatcacgccgatcgggcggaagcgccgctgttcgagcggcgcgtgcgcgcgaacgcg
ccggccgagctgttcgacggcggcttcgtcacgctggccggcgcgcaggtcgatgcggcc
gagcccgcgctcgcggggcgcttcgcgcgcggcctgctgctgccgcgcgaaggccagctc
gacaaccggcaggcgctgcgcgcgctggcggcgggcctcgcgcagcgcggcgtcgagctg
cactggcacgcgacgatcgacgacgcgaaccaccccgacgcacatttcacgatcgattgc
cgcggcctcggcgcgaaagccgcgctgcccgcgctgcgcggcatccgcggcgaagtcgcg
cgggtgcgcgcgcccggcatcgggctcacgcggcccgtgcggctgctgcatccgcgctat
ccgctgtatatcgcgccgaaacaggacgacctgtacgtgatcggcgcgaccgaggtggag
ggcgaggacatgtcgcccgtcagcgtgcgctccgcgctcgaactgctgagcgcggcgttc
tccgtgcacccggcgttcggcgaggcgcgcatcctcgaactcaatgcgcagtgccgcccg
acgctgcccgaccaccgcccggcggtgatctgggacggcgcgacgacgctcgccgtcaac
ggcctgtaccggcacggcttcatgattgctccggaagtcgcgcatgcggcggtcgcgttc
gcgcaggccgcgctcggcggcgcgttcgccgatgccgatgcgttcaccgcgtggcgcgat
gccgcgcgctggccggcgctccttcatcaccgcgacgacgcgcgccagccggcctga

DBGET integrated database retrieval system