KEGG   Burkholderia ambifaria MC40-6: BamMC406_0490Help
Entry
BamMC406_0490     CDS       T00684                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00473  D-Alanine metabolism
bac00550  Peptidoglycan biosynthesis
bac01100  Metabolic pathways
bac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BamMC406_0490
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BamMC406_0490
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BamMC406_0490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bac01011]
    BamMC406_0490
Enzymes [BR:bac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BamMC406_0490
Peptidoglycan biosynthesis and degradation proteins [BR:bac01011]
 Precursor biosynthesis
  Amino acid ligase
   BamMC406_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATPgrasp_ST ATP-grasp_4 TTL ATPgrasp_YheCD PPR
Motif
Other DBs
NCBI-ProteinID: ACB62987
UniProt: B1YSS6
LinkDB All DBs
Structure
PDB: 

Position
1:556839..557780
Genome map
AA seq 313 aa AA seqDB search
MSGIDPKRFGKVAVLFGGESAEREVSLTSGRLVLQGLRDAGIDAHPFDPAERPLSALKDE
GFVRAFNALHGGYGENGQIQGALDFYGIRYTGSGVLGSALGLDKFRTKLVWQQTGVPTPP
FETVMRGDDYAARATDIVAKLGLPLFVKPASEGSSVAVLKVKTADALPAALSEAATHDKI
VIVEKSIEGGGEYTACIAGDLDLPLIKIVPAGEFYDYHAKYVANDTQYLIPCGLPAEQET
ELKRIARRAFDVLGCTDWGRADFMLDAAGNAYFLEVNTAPGMTDHSLPPKAARSIGIGYS
ELVVKVLSLTLND
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatcgatccgaaacgtttcggcaaggtggcagtgttgttcggcggcgaatcc
gccgagcgcgaggtgtcgctcacctcgggccgcctcgtgctgcagggcctgcgcgacgcg
ggcatcgacgcgcatccgttcgacccggccgagcggccgctgtcggcgctgaaggatgaa
ggcttcgtgcgcgcgttcaacgcgctgcacggcggctatggcgagaacggccagatccag
ggcgcgctcgatttctacgggattcgctacacgggcagcggcgtgctcggctcggcgctt
ggtctcgacaagttccgcacgaagctcgtgtggcagcagacgggcgtgccgacgccgccg
ttcgagacggtgatgcgcggcgacgactacgcggcgcgcgcgacggacatcgtcgcgaag
ctcggcctgccgctgttcgtgaagccggcgagcgaaggctcgagcgtcgcggtgctgaag
gtcaagacggccgacgcgttgcccgccgcactgtcggaagccgcgacgcacgacaagatc
gtgatcgtcgagaagagcatcgaaggcggcggcgaatacaccgcgtgcatcgccggcgat
ctcgatctcccgctgatcaagatcgtgccggcgggcgagttctacgactaccacgcgaag
tatgtcgccaacgatacgcagtacctgattccgtgcgggctgccggcggagcaggaaaca
gaactgaagcgcatcgcgcgccgcgcgttcgacgtgctcggctgcaccgactggggccgc
gcggatttcatgctcgacgccgccggcaacgcgtatttcctggaagtgaacacggccccc
gggatgaccgaccattcgctgccgccgaaggccgcgcgctcgatcggcatcggctattcg
gagctggtcgtgaaggtgctgtcgcttacgctcaacgactga

DBGET integrated database retrieval system