KEGG   Burkholderia ambifaria MC40-6: BamMC406_1940Help
Entry
BamMC406_1940     CDS       T00684                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00473  D-Alanine metabolism
bac01100  Metabolic pathways
bac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BamMC406_1940
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BamMC406_1940
Enzymes [BR:bac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BamMC406_1940
Peptidoglycan biosynthesis and degradation proteins [BR:bac01011]
 Precursor biosynthesis
  Racemase
   BamMC406_1940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACB64422
UniProt: B1YSI6
LinkDB All DBs
Position
1:complement(2162853..2163923)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRFAGPSKVWTVVKANAYGHGLARVFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYAPEKYRAAWERARACPGIGQITLMTHFSDADNERGVAEQLATFERGA
ENIAGARSLANSAAVLWHPDTHFDWVRPGIMLYGASPSGLSADIADTGLKPAMTLASELI
AVQTIAKGQAIGYGSTFSAPAQMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNALPIDDVARHCGTIGYELMCAVAGRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccataccgccgctctcgcgaacaatctctccgtc
gtccgccgctttgccggcccgtccaaggtctggacggtcgtcaaggccaacgcgtacggc
cacggtctcgcgcgcgtgtttcccggcctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggccgtgaagctgcgcgagctggggtgggccggtccgatcctgctgctcgag
gggttcttccgctcgaccgacatcgacgtgatcgaccgctacagcctgacgaccaccgtc
cacaacgacgagcagatgcggatgctggagacggcgcggctgtcgaagcccgtcaacgtg
cagctcaagatgaacagcggcatgaaccggctcggctacgcgccggagaaataccgcgcc
gcgtgggagcgcgcccgtgcgtgccccggcatcggccagatcacgttgatgacccatttt
tcggatgccgacaacgagcgcggcgtcgccgagcagctcgcgacgttcgagcgcggcgcg
gaaaacatcgccggcgcgcgcagcctcgcgaattcggcggccgtgctgtggcatccggat
acgcacttcgactgggtgcgcccggggatcatgctctacggcgcgtcgccgtcgggactg
tcggccgacatcgccgacaccgggttgaagcccgcgatgacgctcgcgtccgagctgatc
gcggtgcagaccatcgcgaaggggcaggcgatcggctatggctcgacgttctccgcgccg
gcccagatgcgcatcggcgtcgtcgcgtgcggctacgcggacggctatccgcgcgtcgcg
cccgaaggcacgcctgtgatcgtcgacggcatccgcacgcggatcgtcggccgcgtgtcg
atggacatgatcacggtcgacctcacaccgtgcccgcaggccggggtcggcgcgcgggtc
gagctgtggggcaacgcgctgccgatcgacgacgtcgcgcgccattgcgggaccatcggc
tatgaactgatgtgcgcggtcgccggccgcgtgccggtgcgcgcggaataa

DBGET integrated database retrieval system