KEGG   Burkholderia ambifaria MC40-6: BamMC406_2045
Entry
BamMC406_2045     CDS       T00684                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00010  Glycolysis / Gluconeogenesis
bac00020  Citrate cycle (TCA cycle)
bac00260  Glycine, serine and threonine metabolism
bac00280  Valine, leucine and isoleucine degradation
bac00310  Lysine degradation
bac00380  Tryptophan metabolism
bac00620  Pyruvate metabolism
bac00630  Glyoxylate and dicarboxylate metabolism
bac00640  Propanoate metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01200  Carbon metabolism
Module
bac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bac_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
bac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BamMC406_2045
   00020 Citrate cycle (TCA cycle)
    BamMC406_2045
   00620 Pyruvate metabolism
    BamMC406_2045
   00630 Glyoxylate and dicarboxylate metabolism
    BamMC406_2045
   00640 Propanoate metabolism
    BamMC406_2045
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BamMC406_2045
   00280 Valine, leucine and isoleucine degradation
    BamMC406_2045
   00310 Lysine degradation
    BamMC406_2045
   00380 Tryptophan metabolism
    BamMC406_2045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bac04147]
    BamMC406_2045
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     BamMC406_2045
Exosome [BR:bac04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BamMC406_2045
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Biotin_lipoyl Pyr_redox Biotin_lipoyl_2 FAD_oxidored GIDA Pyr_redox_3 AlaDh_PNT_C NAD_binding_8 FAD_binding_2 Thi4 GCV_H DAO HI0933_like FAD_binding_3 NAD_binding_7 HlyD_D23 Peptidase_M23 3HCDH_N
Other DBs
NCBI-ProteinID: ACB64526
UniProt: B1YT37
LinkDB
Position
1:complement(2276235..2278013)
AA seq 592 aa
MSLIEVKVPDIGDFSGVDVIEVNVKPGDVIEKEQTLITLESDKASMEVPSDVAGTVKEVK
VKAGEKVSQGTVIAIVEAAAGDAAPAKAPEAAKPAPAAPAPAAAAPAAAPAAAPQAGSYS
GAADIECDMLVLGAGPGGYSAAFRSADLGMKTVLVERYSTLGGVCLNVGCIPSKALLHTA
LVIDEAAALASHGITFGKPEVDLDKLRDFKGGVVKKLTTGLAGMAKARKVEVVTGVGAFV
DPYHMEVQGENGKKVVKFKQAIIAAGSQAVKLPFMPEDPRVVDSTGALELRQLPKRMLVI
GGGIIGLEMATVYATLGAEIDVVEMMDGLMMGADRDLVKVWEKYNAKRFGNVMLKTKTVG
AEAKEEGIYVKFEGEKAPAEAQRYDLVLVAVGRSPNGKKIGADKAGVAVTDRGFIDVDKQ
MRTNVPHIFAIGDVVGQPMLAHKAVHEGHVAAEAAHGEKAYFDALQIPSVAYTDPEVAWA
GKTEDQCKAEGIKYGKAVFPWAASGRAIANGRDEGFTKLIFDEETHRVIGGGIVGLNAGD
LISEVCLAVEMGADAEDIGKTIHPHPTLGESVGMAAELYEGVCTDLPPQRKK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgagtctcatcgaagtcaaggttccggatatcggcgatttcagcggcgtcgatgtcatc
gaagtcaacgtcaagccaggcgacgtgatcgaaaaagaacaaacgctcatcacgctcgaa
tccgataaagcctccatggaagtgcccagcgacgtcgccggcacagtcaaggaagtcaag
gtcaaggccggcgagaaagtctcgcaaggcaccgtcatcgccatcgtcgaagcagcagcc
ggcgacgccgcacccgcgaaagcacccgaggcagcgaaacccgcaccggctgcgcccgct
ccggccgcagccgctcccgcagccgctcccgcagccgcgccgcaagccggcagctacagc
ggcgccgccgacatcgagtgcgacatgctcgtgctcggcgccggccccggcggctattcg
gccgcgttccgctcagccgacctcggcatgaagacggtgctggtcgaacgctactcgacg
ctcggcggcgtatgcctgaacgtcggttgcatcccgtcgaaggcgctgctgcacacggca
ctcgtcatcgacgaagccgcggcgctcgcatcgcacggcatcacgttcggcaagccggag
gtcgatctcgacaagctgcgcgacttcaagggcggcgtcgtcaagaaactgacgacgggc
ctcgccggcatggcgaaggcgcgcaaggtcgaagtcgtcacgggcgtcggcgcattcgtc
gatccgtatcacatggaagtgcagggcgaaaacggcaagaaggtcgtcaagttcaagcag
gcgatcatcgccgcgggctcgcaagcggtgaagctgccgttcatgccggaagacccgcgc
gtcgtcgattcgacgggcgcgctcgaactgcgccaactgccgaagcggatgctcgtgatc
ggcggcggcatcatcggcctcgaaatggccacggtgtatgcgacgctcggcgccgagatc
gacgtggtcgaaatgatggacggcctgatgatgggcgcggaccgcgatctcgtgaaggtc
tgggaaaagtacaacgcgaagcgcttcggcaacgtgatgctgaagaccaagacggtcggc
gcggaagcgaaggaagaaggcatctacgtgaagttcgagggcgagaaggcgccggcggaa
gcgcagcgctacgacctcgtgctcgtcgcggtgggccgcagcccgaacggcaagaagatc
ggcgccgacaaggccggcgtcgccgtcaccgaccgcggcttcatcgatgtcgacaagcag
atgcgcacgaacgtcccgcacatcttcgcgatcggcgacgtcgtcggccagccgatgctc
gcgcacaaggccgtgcatgaaggccacgtcgcggcggaagccgcgcacggcgagaaggcg
tacttcgacgcgctgcagatcccgtcggtggcgtacaccgatccggaagtggcgtgggcc
ggcaagacggaagaccagtgcaaggccgaaggcatcaagtacggcaaggcggtgttcccg
tgggccgcatcgggccgcgcgatcgcgaacggtcgcgacgaaggcttcacgaagctgatc
ttcgacgaggaaacccatcgcgtgatcggcggcggcatcgtcggcctgaacgcgggcgac
ctgatcagcgaagtgtgtctcgccgtcgagatgggcgcggacgccgaagacatcggcaag
acgatccatccgcacccgacgctcggcgaatcggtcggcatggccgccgagctgtacgaa
ggcgtgtgtaccgatctgccgccgcaacgcaagaagtaa

DBGET integrated database retrieval system