KEGG   Burkholderia ambifaria MC40-6: BamMC406_2143Help
Entry
BamMC406_2143     CDS       T00684                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bac00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BamMC406_2143
Enzymes [BR:bac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BamMC406_2143
Transporters [BR:bac02000]
 Other Transporters
  Pores ion channels [TC:1]
   BamMC406_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_N_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ACB64622
UniProt: B1YTN4
LinkDB All DBs
Position
1:complement(2394565..2395221)
Genome map
AA seq 218 aa AA seqDB search
MLQLCGIPLSNYYNKVKFVLLEHDIPFEEATCTLPVSDPALLADSPLGKIPFLKTEEGAL
FESQVIIEYLAARYPDKAIFPAGPFAAAKVRELVETLELYLEWTAREVYTEAFFGGKVSD
GTKAHVEKRLPRAIDAFKRMTQFSPYVLGDTFGLADIAASVHLPVIGMATKAIFGRDFLL
DAGIDWKAHAKLVGERPAAQRVAADRKAYVEATAAARQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctacagctgtgcggtattccgttgtccaactattacaacaaggtgaagttcgtcctg
ctcgaacatgacatcccgttcgaggaagcgacatgcacgttgccggtcagcgatcctgca
ttgctcgccgattcgccgctcggcaagattccgttcctgaagacggaagagggcgcgctg
ttcgagtcgcaggtgatcatcgaatatctggcagcgcgttatcccgacaaggcaattttc
ccggcggggccgttcgcggccgcgaaggtgcgcgaactcgtcgagacgctcgagctgtat
ctcgaatggaccgcgcgcgaggtctatacggaggcgtttttcggcggcaaggtcagcgac
gggaccaaggcgcatgtcgagaagcgcctgccgcgtgcgatcgatgcattcaagcggatg
acgcaattctcgccctacgtgctcggcgacacgttcggtcttgcggacatcgccgcatcg
gtccacctgccggtgatcgggatggcgacgaaggccatcttcggccgcgatttcctgctc
gatgccggcatcgactggaaggcgcacgcgaagctggtcggcgagcggccggccgcgcag
cgcgtggcggccgatcgcaaggcctatgtcgaggcgacggccgccgcgcgtcagtaa

DBGET integrated database retrieval system