KEGG   Burkholderia ambifaria MC40-6: BamMC406_2335Help
Entry
BamMC406_2335     CDS       T00684                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00620  Pyruvate metabolism
bac00680  Methane metabolism
bac00710  Carbon fixation in photosynthetic organisms
bac01100  Metabolic pathways
bac01120  Microbial metabolism in diverse environments
bac01200  Carbon metabolism
Module
bac_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BamMC406_2335
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BamMC406_2335
   00680 Methane metabolism
    BamMC406_2335
Enzymes [BR:bac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BamMC406_2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACB64813
UniProt: B1YUR7
LinkDB All DBs
Position
1:2598943..2601939
Genome map
AA seq 998 aa AA seqDB search
MKSSGSARTTRRNAALPSSDAQTGTIATAANGRAKTATKPKDPIPRTKRAIKTSGPAART
AKPGVRTREDKDGPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDDSEA
AQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTVAYA
LEQLKTTGNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTA
RERSYNESMLRARVTALWQTRMLRDSRLTVGDEIENALSYYRATFLDELPALYGDIEAAL
AEHGLPARVPAFFQMGSWIGGDRDGNPNVTGPTLDEAINRQAAVILEHYLEQVHKLGAEL
SVSNLLVGANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVPVRS
AGRGAPPVRAIPYADSEAFVADLKVLTASLEEHHGASLAAPRLTPLVRAAEVFGFHLASI
DLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSALAQ
SELGVFEKAREVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLEGPLGSHAKNGL
MVIPLFETIPDLRDAARIMREYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGFLTSNWE
LYRAELALVDVFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEV
IASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDAAMASYRALVY
ETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLT
GWYGFGSAVSAYLDGAPDAAERTKRLTLLKKMNKTWPFFANLLSNMDMVLAKTDLAVASR
YAQLVADRKLRKHVFERIVAEWERTSQALAEITGHEGRLATNPLLARSIKNRFPYLDPLN
HLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacgacgcgccgcaatgctgccctgccctcctccgac
gcccagacgggtaccatcgccaccgccgcgaacggccgtgcgaaaacggcaacgaaaccg
aaagacccgatacctcggacaaaacgcgcgatcaagacctcgggcccggctgcccgcacc
gcgaagcccggcgtgcgcacgcgcgaggacaaggacggcccgctgttcgaggacatccgc
ttcctcggccgcctgctcggcgacgtggtgcgcgaacaggaaggcgacaccgtattcgac
gtcgtcgaaacgatccgccagaccgcggtgaagttccgtcgcgaagacgacagcgaagcc
gcgcaaaccttggaaaagaagctgcgcaagctgacgccggagcagacggtgagcgtcgtg
cgcgcgttcagctatttctcgcacctcgcgaacatcgcggaagaccgccaccacaaccgc
cgccgtcgcatccacgcgctggccggctccgcgccgcagcccggcaccgtcgcgtacgcg
ctcgaacagctgaagacgaccggcaacgcgtcgaagcgcctgctgcagcgcttcttcgac
gatgcgctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgcaagagcatc
ctcgacgcgcagcacgacatcgcgcggctgctcgccgagcgcgaccagccgctcaccgcg
cgcgaacgctcgtacaacgaatcgatgctgcgcgcgcgcgtgaccgcgctgtggcagacc
cgcatgctgcgcgactcgcgcctgacggtcggcgacgagatcgagaacgcgctgtcgtac
taccgcgcgacgttcctcgacgagctgcccgcgctgtacggcgacatcgaggccgcgctc
gccgagcacggcctgccggcgcgcgtgcccgcgttcttccagatgggcagctggatcggc
ggcgatcgcgacggcaacccgaacgtcacgggccccacgctcgacgaggcgatcaaccgc
caggccgcggtgatcctcgaacattacctggaacaggtgcacaagctcggcgcggagctg
tcggtgtcgaacctgctggtcggcgcgaacgacgcggtgaaggcgctcgcggcagcctcc
cccgaccagtcgccgcaccgcgtcgacgaaccgtatcgccgcgcgctgatcggcatctac
acgcggctcgccgccagcgcgcgtgtgcgccttggcgaaggcacggtgccggtgcgcagc
gcgggccgcggcgcgccgccggtgcgcgcgattccgtacgcggattccgaagcgttcgtc
gccgacctgaaggtgctgaccgcatcgctcgaagaacaccacggcgcgtcgctcgccgcg
ccgcgcctgactccgctggtgcgcgcggccgaagtgttcggcttccatctcgcgagcatc
gacctgcgccagagctccgacatccacgaagccgtggtcgccgagctgttcgcgcgtgcc
ggcgtcgaagccgactacgcggcgctcgccgaggaagacaagctgcgcgtgctgctggcc
gcgctcgccgatccgcgcccgctgcgctcgccgtacctcgaatactcggcgctcgcgcag
agcgagctcggcgtgttcgagaaggcccgcgaggtgcgcgcgcagttcggcgcgcgcgcg
gtgcgcaactacatcatctcgcatacggaaaccgtcagcgacctcgtcgaggtgctgctg
ctgcagaaggaaacggggctgctcgaaggcccgctcggcagccatgcgaagaacggcctg
atggtgattccgctgttcgagacgatccccgacctgcgcgacgccgcgcggatcatgcgc
gagtacttcgcgctgccgggcatcgacgcgctgatcgcgcaccagggcgccgagcaggag
gtgatgctcggctactcggacagcaacaaggacggcggcttcctgacgtcgaactgggag
ctgtatcgcgccgaactcgcgctcgtcgacgtgttccgcgaacgcaagatcacgctgcgg
ctgttccatggccgaggcggcacggtgggccgcgggggcggcccgacctaccaggcgatc
ctgtcgcagccgccgggtaccgtgaacggccagatccgcctgaccgaacagggcgaggtg
atcgcgagcaagttcgcgaaccccgaaatcggccggcgcaacctcgagacggtggtcgcc
gcgacgctcgaggcgtcgttgctgccgcagtcgaacgcgcccgcgcaactgcccgcgttc
gaagccgcgatgcagacgctgtcggacgccgcgatggcgtcgtatcgcgcgctcgtctat
gaaacgcccggcttcaccgactacttcttctcgtcgacgccgatcaccgagatcgcggag
ctgaacatcggcagccgcccggcctcgcgcaagctgcaggatccgaagaaccgcaagatc
gaggatctccgcgcgattccgtggggcttctcgtggggtcagtgccggctgctgctgacg
ggctggtacggcttcggcagcgcggtgagcgcgtatctcgacggcgcgccggacgcggcc
gaacgcaccaagcgcctgacgctgctcaagaagatgaacaagacctggccgttcttcgcg
aacctgctgtcgaacatggacatggtgctcgcgaagaccgatctcgcggtcgcgtcgcgc
tatgcgcagctggtcgccgaccgcaagctgcgcaagcacgtgttcgagcggatcgtcgcg
gaatgggagcgcacgtcgcaggcgctcgcggaaatcaccgggcacgaaggccgcctcgcg
accaacccgctgctcgcgcgttcgatcaagaaccgcttcccgtatctcgatccgctgaac
cacttgcaggtcgagctgatcaagcgtcaccgcgcgggcgacacgaacgcgcggctgcgc
cgcgggattcacctgaccatcaacgggatcgcggccggcctgcgcaacacgggctga

DBGET integrated database retrieval system