KEGG   Burkholderia ambifaria MC40-6: BamMC406_2443Help
Entry
BamMC406_2443     CDS       T00684                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00020  Citrate cycle (TCA cycle)
bac00480  Glutathione metabolism
bac01100  Metabolic pathways
bac01110  Biosynthesis of secondary metabolites
bac01120  Microbial metabolism in diverse environments
bac01130  Biosynthesis of antibiotics
bac01200  Carbon metabolism
bac01210  2-Oxocarboxylic acid metabolism
bac01230  Biosynthesis of amino acids
Module
bac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bac_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BamMC406_2443
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BamMC406_2443
Enzymes [BR:bac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BamMC406_2443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACB64921
UniProt: B1YVB7
LinkDB All DBs
Position
1:complement(2716201..2717457)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDYSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggagggcggtgacaagatcaccgtcaacaaggac
tactcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtcgtcgacgcggcggtggcccatgcctacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgacgaaggtgtac
ggtccggacgtgtggctgccggacgaaacgctgcaggtgctgaaggaatacgtggtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggaactcgacctgtacgtgtgcctgcgcccggtccagtatttcaagggcgtgccc
tcgccggtgcgcgagccgcaaaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgagtgggccgcgggctccgagcaggcgaagaaggtgatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgcttcccggaaacctcggggatcggcgtc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtatgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggaattcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcaacgagatcgtcatcaag
gattcgatcgccgatgcattcctgcagcagatcctgctgcgtccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcactggccgcgcaggtcggc
ggcatcgggatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgaca
cacggcacggcgccgaagtacgcgggcaaggattacgtgaaccccggttcggagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcggccgacacgatcatcgcc
gcgatggaaaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctccggcttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system