KEGG   Burkholderia ambifaria MC40-6: BamMC406_3046
Entry
BamMC406_3046     CDS       T00684                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bac  Burkholderia ambifaria MC40-6
Pathway
bac00970  Aminoacyl-tRNA biosynthesis
bac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bac00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BamMC406_3046
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bac03029]
    BamMC406_3046
Enzymes [BR:bac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BamMC406_3046
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BamMC406_3046
Mitochondrial biogenesis [BR:bac03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BamMC406_3046
SSDB
Motif
Pfam: Amidase YcaO
Other DBs
NCBI-ProteinID: ACB65522
UniProt: B1YPV8
LinkDB
Position
1:complement(3382986..3384476)
AA seq 496 aa
MHAKSLTELRAALAAKECSAVELAQLYLKRIDAARDLNAFVHVDADLTLAQAKAADAELA
RGAGGALTGLPIAHKDVFVTRGWRSTAGSKMLANYESPFDATVVARLQAAGMVTLGKTNM
DEFAMGSSNENSAFGAVKNPWDTNAVPGGSSGGSSAAVAARLAPAATGTDTGGSIRQPAS
FAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMAQSASDCALLLNAMSGFDERDSTSLERE
DEDFTRHLGQPWAAGNDAGKPLAGLRIGLPNEYFGDGLADDVRASIDAALKAYEALGATL
VPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAQYGDLLDMYKKSRAEGFGPE
VKRRILVGAYVLSHGYYDAYYLQAQKIRRIIAQDFQEAFKSCDVIMGPASPTVAWDLGAK
GDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAKRPVGLQIIGNYFNEARMLQVAD
AFQRATDWHKQVPAGV
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgcacgcaaaaagcctgaccgaactgcgcgccgcgctcgccgccaaggaatgctcggcc
gtcgagctcgcgcagctctacctgaaacggatcgacgcggcacgcgacctgaacgcgttc
gtccacgtcgacgccgacctcacccttgcgcaggcgaaggccgccgacgccgaactcgcg
cgcggcgcgggcggcgcgctgaccggcctgccgatcgcgcacaaggacgtgttcgtcacg
cgcggctggcgctcgaccgccggctcgaagatgctcgcgaactacgagagcccgttcgac
gcgaccgtcgtcgcccgcctgcaggcggccggcatggtcacgctcggcaagaccaacatg
gacgagttcgcgatgggctcgtcgaacgagaactccgcgttcggcgcggtgaagaacccg
tgggataccaacgcggtgccgggcggcagctcgggcggcagctcggccgccgtcgccgcg
cgcctcgcgccggccgcgaccggcaccgacaccggcggctcgatccgccagcccgcgtcg
ttcgcgggcgtgacgggcatcaagccgacctacggccgcgtgtcgcgctacgggatgatc
gcgttcgcgtcgtcgctcgaccagggcggcccgatggcgcagagcgcgtccgactgcgcg
ctgctgctcaacgcgatgtccggcttcgacgagcgcgactcgacgagcctcgagcgtgaa
gacgaggatttcacgcgccacctcggccagccgtgggcggccggcaacgacgcgggcaag
ccgcttgccgggctgcgcatcggtctgccgaacgagtatttcggcgacggcctcgccgac
gacgtgcgtgcgtcgatcgacgcggcgcttaaagcatacgaggcgctcggcgcgacgctc
gtgccggtgtcgctgccgaaaaccgaactgtcgattcccgtgtactacgtgatcgcgccg
gcagaggcgtcgtcgaacctgtcgcgcttcgacggcgtgcgattcggccaccgcgccgcg
cagtacggcgatctgctcgacatgtacaagaagtcgcgcgccgaaggcttcggccccgag
gtgaagcgccggattctcgtcggcgcctacgtgctgtcgcacggctactacgacgcgtac
tacctgcaggcgcagaagatccgccgcatcatcgcgcaggatttccaggaagcgttcaag
tcctgcgacgtgatcatgggcccggcgtcgccgacggtcgcatgggatctcggcgcgaag
ggcgacgatccggtgcagatgtatctcgcggatatctacacgctgtcggtgagcctcgcc
ggcctgcccggcatgagcgtgccgtgcggcttcggcgcgggcgcgaacgcgaagcgcccg
gtcggtctgcagatcatcggcaactatttcaacgaagcccggatgctgcaggtcgccgac
gcgttccagcgcgcgaccgactggcacaagcaagttccggcgggagtgtaa

DBGET integrated database retrieval system